SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008758 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008758
Domain Number 1 Region: 280-433
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.09e-26
Family DnaQ-like 3'-5' exonuclease 0.00092
Further Details:      
 
Domain Number 2 Region: 570-744
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.42e-20
Family Canonical RBD 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008758   Gene: ENSMODG00000007059   Transcript: ENSMODT00000008931
Sequence length 847
Comment pep:novel chromosome:BROADO5:6:60033856:60078377:1 gene:ENSMODG00000007059 transcript:ENSMODT00000008931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGWLEPGKEGLSMLTNVALYSKDKREPQTLVGQRRKRSLLGRRMDAALIGKSKKRKQP
QNEFFIGSGEETTNGDPDDEESQPKWKKARLSTKLFVNNYEISHDQLRELLKSAALGKLS
ISDEQGAPNLSWCHLSHPKHLNSVVVIVLQGVSQLHFYKFFLQFKHLRKAFRHRFRLPAP
SANFLADVIGEQPNGNKEERILPTPNTMQVSSSLTSPQAITDLHSDPIIQKYGYDKVGLV
RCLLTKEEMKKFDFPLQGLDTCKNFIPTECLGPVNDSSPLFGLDCEMCLTPNGNELTRVS
LVDAEGHCVMDELVKPDNKILNYLTRFSGITRKILKPVTTRLRDVQVKLKKLLPPDAVLV
GHSLNADLKALQMIHLNVIDTSLLFVRDLGRRFKLKFLAKAVLGKEIQCPDRVGHDSTED
AIATLELAQYFIKHGPRKIAEMKLDTAVHSQQSLASPKQKNTLPLCPSGPNKEASTDAMW
QKNAGILECLDLTGQKLLFLSQKAGGNAFTSSRFCRSILCTSDEEVLEQAQAEVPLSSFS
IIQFSQCPHPLSPSLTVEMHQKMKIKWAEMSTVYAGPFGENFCLKPLKKLFASFGPVHSM
EVILETDEPYLCIHYGVLEAAQLAIETLNGACVQGSRIKVQRPVQELTLDCDTIVSTLET
DPENESTIYVNGMKESYTKEDMSQKFSLLPSLEAIFLPVDPQSKKHKKYCFLKFRSFECA
QSALKILQGPTGLSWKLVCRKALTPNHLHEWICHSYPDPRSPQASDVVSLDPKEKSPSVN
KSPQGEELKIAMSRFDERVRKLHERLPPSTLCIVLLPGMQSVHGSSAGLGLISVNGDDRK
SAVPEGL
Download sequence
Identical sequences F6UF45
ENSMODP00000008758 ENSMODP00000008758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]