SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009224 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009224
Domain Number 1 Region: 494-659
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 9.68e-72
Family A middle domain of Talin 1 0.0000000347
Further Details:      
 
Domain Number 2 Region: 759-894
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.16e-53
Family I/LWEQ domain 0.000000298
Further Details:      
 
Domain Number 3 Region: 2297-2488
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.69e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 664-788
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.06e-48
Family I/LWEQ domain 0.000000594
Further Details:      
 
Domain Number 5 Region: 1847-1979
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 8.63e-44
Family VBS domain 0.000000697
Further Details:      
 
Domain Number 6 Region: 1231-1367
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.35e-38
Family VBS domain 0.014
Further Details:      
 
Domain Number 7 Region: 201-314
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-34
Family Second domain of FERM 0.000000502
Further Details:      
 
Domain Number 8 Region: 1081-1213
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.14e-26
Family VBS domain 0.02
Further Details:      
 
Domain Number 9 Region: 315-405
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 10 Region: 1423-1561
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000209
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 1701-1821
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000022
Family VBS domain 0.018
Further Details:      
 
Domain Number 12 Region: 85-141
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000292
Family First domain of FERM 0.051
Further Details:      
 
Domain Number 13 Region: 2016-2138
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000565
Family VBS domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000009224
Domain Number - Region: 1604-1665
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0011
Family VBS domain 0.057
Further Details:      
 
Domain Number - Region: 955-1048
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00124
Family I/LWEQ domain 0.0039
Further Details:      
 
Domain Number - Region: 2106-2233
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0497
Family I/LWEQ domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009224   Gene: ENSMODG00000007430   Transcript: ENSMODT00000009405
Sequence length 2543
Comment pep:known_by_projection chromosome:BROADO5:6:122650901:122680085:1 gene:ENSMODG00000007430 transcript:ENSMODT00000009405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RREAANMVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEALAGPPNDFGLFLSDD
DPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGAVKTIMVDDSKTVTDMLMT
ICARIGITNHEEYSLVRELLEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWL
DHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDK
ACEFAGFQCQIQFGPHNEQKHKPGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEA
KVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLT
NIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGD
EESTMLEDSVSPKKSTVLQQQYNRIGRVEHGSVALPAIMRSGASGPENFQMGSMPPAQQQ
ITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKN
KMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKML
AALLEDEGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQ
IGESDTDPHFQDMLMHLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTS
QLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVAASQAATEDGSLLRGVGAAATAV
TQALNELLQHVRAHATGGRPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATS
DLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAA
EGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASAPKAPAGPQPLLVQ
SCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQ
ASAMQLSQCAKTLGTALAELRTAAQKAQEACGPLEMDSALSLVQSLERDLQEVKAAARDG
KLKPLPGETMEKCAQDLGNSTKAVSSSIAQLLGEVAQGNENYAGIAARDVAGGLRALAQA
ARGVAALTSEPAVQAAVLDTASDVLDKASSLIDEAKKAASRPRDPESQQRLAQVAKAVTQ
ALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAAT
ELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDQAQVVSNLKGISMSSSK
LLLAAKALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVR
ELLENPAQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNSNLPEFGEAIRTASKALC
GFTEAAAQAAYLVGISDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSA
ATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEEN
RAQCRAATAPLLEAVDNLSAFAANPEFSSIPAQISPEGRAAMEPIVVSAKTMLESAGGLI
QTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQRECEAAIAALNSCLRD
LDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQM
AQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQE
ALEEAVQMVTEAVEDLTATLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPDGSFVDYQ
TTMVRTAKAIAVNVQEMVTKSSTSPEELGPLANQLTSDYGRLALQAKPAAMAAENEEIGA
HIKHRVQELGHGCAALVTKAGALQCSPSDAYTRKELMECARRVSEKVSHVLAALQAGNRG
TQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKALVEDTKVLV
QNAAASQEKLAQAAQSSVGTITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDL
ISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIR
QELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIAD
MLRACKEAAYHPEVAPEVRLRALHYGREANGYLELLDHTLQKPSPELKQQLTGHSKRVAG
SVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADES
LNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAAR
MVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQA
AGNAVKRASDNLVKAAQKAAAFEDQENETVVVKERMVGGIAQIIAAQEEMLRKERELEEA
RKKLAQIRQQQYKFLPSELRDEG
Download sequence
Identical sequences F7DWL1
ENSMODP00000009224 ENSMODP00000009224 13616.ENSMODP00000009224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]