SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010729 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010729
Domain Number 1 Region: 218-361
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-37
Family Third domain of FERM 0.0025
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-31
Family Second domain of FERM 0.000075
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-26
Family First domain of FERM 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010729   Gene: ENSMODG00000008623   Transcript: ENSMODT00000010941
Sequence length 597
Comment pep:known_by_projection chromosome:BROADO5:6:128237717:128582567:1 gene:ENSMODG00000008623 transcript:ENSMODT00000010941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAPCHCVQGGRRTMKMIRFRSSSIKSLSQEMKCTIRLLDDSEISCQIQRETKGQFLIDH
ICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIAKQMKSHPPYTMCFRVKFYPHEPLKIK
EELTRYLLYLQIKRDIFHGRLLCSFTDAAYLGACIVQAELGDYDPDEHPENYISDFEIFP
KQSHKLERKIMEIHRNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFT
ASGFVVFQGNKRIHLLKWSDVCKLKYEGKTFYALGSQKEKKAMLAFHTSTPAACKHLWKC
GVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGRVAKEVVEASSKIQRDPPEVHRANI
TQSKSSHSLNKQLIINMEPLQPLLPSPSEQEEEVHLDGGIPLLREDDRTAPVISSSPIKN
LREYGDFSREHEEKIKEEPLAISELVYNPSTSLLPTPVDEDEIDMLFDCPSRLELEREDT
DSFEDLEADENAFLMAEEEELKEARRALTWSYDILTGNIQVNPFVKSFSRLLVVGLGLLL
FVFPLLLVLLESGIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVARKINFILYLLGCS
Download sequence
Identical sequences F6PGZ8
ENSMODP00000010729 13616.ENSMODP00000010729 XP_001368599.1.35504 ENSMODP00000010729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]