SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010803 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010803
Domain Number 1 Region: 21-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.71e-71
Family Eukaryotic proteases 0.000000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010803   Gene: ENSMODG00000008681   Transcript: ENSMODT00000011016
Sequence length 269
Comment pep:known_by_projection chromosome:BROADO5:Un:54527573:54535762:-1 gene:ENSMODG00000008681 transcript:ENSMODT00000011016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPLRTLLLLLASLQGSLVLSSRIVGGRPAIPHSRPYMVSLQVQGNHFCGGTLIHPQF
VMTAAHCIDKINPQLVMVVLGAHDLEVPETVWQVFSVQRLYSNDYDDKNNLNDIALIELD
RPATLNAEVQVASLPTQGQALPAGTQCLAMGWGRLGTTLPIPNILQELNVTVVTFLCREH
NICTLAPRQRAGICFGDSGGPLVCQGVVHAVDSFIIGSCASQRYPDFFARVSLYINWINS
ILKKAEEKQKEEKDEDWLWQASGSPIGNP
Download sequence
Identical sequences H9H6A5
ENSMODP00000010803 ENSMODP00000010803 XP_001379973.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]