SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010931 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010931
Domain Number 1 Region: 1143-1335
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.08e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000265
Further Details:      
 
Domain Number 2 Region: 933-1055
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-32
Family Pleckstrin-homology domain (PH domain) 0.00000104
Further Details:      
 
Domain Number 3 Region: 40-165
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010931   Gene: ENSMODG00000008781   Transcript: ENSMODT00000011147
Sequence length 1946
Comment pep:known_by_projection chromosome:BROADO5:8:248224720:248422335:1 gene:ENSMODG00000008781 transcript:ENSMODT00000011147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRWTGLPEGDGDGHQPCGTPIQEVTKNKDGKEQSEAVSPSDDETFSWPGPKTVILKRT
SQGFGFTLRHFIVYPPESAIHFSCKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEA
GLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALA
YSQDAYLKGNEAYSGNAHNIPEPPPICYPRLTPSSSGRAQPVEVAPPDSSLSKQLVSTSG
PTQPGRAYRMEVQVPPSPPDVAKSNTAVCVCNETVRTVIVPSEKAVDLSSGRNNLTGPSH
RTEEIRYGVNEQTSFKTPSRTLSPSSSAPTPHLIHQTPGSRSIDPSGVSMKSGSYGGHSE
GISSSRPQAADTPPVSTNHYSPNSHQHIDWKNYKTYKEYIDNRRLHMGCRTIQERLDSLR
AASQSTTDYSQVVSSRTPWQSRRRSTSHDRAPQPVQIRQRSVSQERLEDPVLMKYWPRSA
SQGALTSPTVSFQSHRTRSWDYLGGQGDASEKANSESLVSDLNGERKQTYKWTGFTEQDD
RRGIYERSRQQDFHKSLRNSNFTVAPSILNSDGRRVSGRGIGSGSQFQKVSPDLKTLQSN
RNFQNAYGTSLPRAISQDRSPLVKVRSNSLKSPSTYVAKPSINQNLIVSIKDQRPVNHLH
SSNLLNQQSRLRAESAPDHMVDSGKTPSPSAASAKLALQMSDSSPPADDLELAAKQNSQE
TEIQLSGSLDNKETVVLREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARRE
VHIKRIEERKASSSSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASATLVPSIAT
IPPSLTTSAPLIRRQLSHDHGSVGPILDGQRNSKTERSKSYDEGLDDYREEAKGSFKHVS
SLKGIKVLDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRQLVTDKGKRVGGSIRPWKQM
YVVLRGHSLYLHKDKREQITPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCEYLFQ
AEDRDDMLAWIKAIQESSSLSEEDTGATSRDLISRRIKEYSNLMSKADQLPKTPRQSLSI
RQTLLGTKSEPKFQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPNIMRKTFEKKPAA
VGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNK
GMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLERLKTLKR
LIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHM
PDQYKIVETLIQHVKEGAEEPLTTVQEENTVESQPVPNIDHLLTNIGRTGVSPGDVSDSA
TSDSAKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKTKEKAQPSSSEDELDNVFFKKEI
AEQPHNDSNIKEDSREESQRENDPGRKQRTSISKENGNKKDSHGRKEEKLTLKKEKVVSG
EPSLSPHNSKHTKSPTLGYRFTVLKEGPQTPSQLPDTPSDSGHLLSASSPLALARFPAKK
SFSPETKCSEFLATASSVTSDYSTTSSAAYLTSLESSRLSPEVQSVAESKGDEADDEQSE
LISEGRPVETDSENDFPVFATGFPSEKFFRGKIQEMVKTSRRNSEGSEVSCTEGSLTPSL
DSRRQPFSSHKLIECDTLSRKKSARFKSESEGIGDTKNEKESLSVTKVFDMKKKGKSTGS
LLTPTRSESEKHEPTWRIKITDRLKLRLKASADDMFGVGSQKNSSADNAKKKNIRRRHTL
GGQRDFAEISVLNTWKVPDQSGERESELSAVTRLKPKCPAQDLSISDWLARERLRTSTSD
LNTGEPGEHRLENTSITEIYKSDGGGSPSTLTLTNRSLPSIPPQSPEQINGETFQNVNQN
ESPLPVANLQKPSLTPGTKSQFHQCL
Download sequence
Identical sequences F6RFP8
ENSMODP00000010931 ENSMODP00000010931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]