SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011100 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011100
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-42
Family Third domain of FERM 0.000000431
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-37
Family Second domain of FERM 0.000000786
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-25
Family First domain of FERM 0.00000532
Further Details:      
 
Domain Number 4 Region: 505-581
Classification Level Classification E-value
Superfamily Moesin tail domain 1.83e-21
Family Moesin tail domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011100   Gene: ENSMODG00000008904   Transcript: ENSMODT00000011317
Sequence length 590
Comment pep:known_by_projection chromosome:BROADO5:3:518164058:518284500:1 gene:ENSMODG00000008904 transcript:ENSMODT00000011317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
QEMWEERITSWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQLKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRVKATAIRTE
EEKRLMEQKVLEAEMLALKMAEESERRAKEADQLKQDLQEARESERRTKQKLLEITSKAT
YTPPVSSSTAALPADMPGFTLIGESLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQL
NELKTEIEALKLKERETALDILHNENSDRGGSKHNTIKKPQAQGRRPICI
Download sequence
Identical sequences F7GLA2
ENSMODP00000011100 ENSMODP00000011100 XP_001380186.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]