SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011803 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011803
Domain Number 1 Region: 29-312
Classification Level Classification E-value
Superfamily L domain-like 2.15e-61
Family Ngr ectodomain-like 0.0025
Further Details:      
 
Domain Number 2 Region: 239-473
Classification Level Classification E-value
Superfamily L domain-like 2.92e-37
Family Internalin LRR domain 0.062
Further Details:      
 
Domain Number 3 Region: 527-826
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.86e-37
Family Rhodopsin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011803   Gene: ENSMODG00000009446   Transcript: ENSMODT00000012026
Sequence length 950
Comment pep:known_by_projection chromosome:BROADO5:5:262287942:262408269:-1 gene:ENSMODG00000009446 transcript:ENSMODT00000012026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCLGLLCFLALGWGSSAGPSGASPPPCPAPCRCDGDRGVDCTGRGLTAVPGGLSAFTHS
LDISMNNITQLPEDAFKNFPFLEELRLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVP
SEAIRGLSALQSLRLDANHITSVPEESFEGLVQLRHLWLDDNSLSEVPVRPLSNLPSLQA
LTLALNKITSIPDFAFNNLSSLVVLHLHNNKIKTLGQHCFDGLDNLETLDLNYNNLGEFP
QAIKALPNLKELGFRSNYISVIPNGAFSGNPLLKTIHLNDNPLSFVGNSAFHNLSELHSL
VIRGAGMVQGFPNLTGTTNLESLTLTGTKISSIPNNLCQDRKKLKTLDLSYNNIQELPSF
HGCSALEEISLQHNQIHEIKESTFQGLTSLRILDLSRNLIQEVHNGAFIKLGSITNLDIS
FNELTSFPTEGLNGLNQLKLTGNFHLKEALSAKDFVNLRSLSVPYAYQCCAFWGCDSYTN
PNADDAGPADHSVSSNQEKADPADLTGRTEKEEHSQTIIHCTPATGAFKPCEYLLGSWMI
RLTVWFIFLVALFFNLLVLVTTFASRAPWPSSKLFIGLISVSNLLTGVYTGILTFLDAVS
WGRFAEFGIWWETGNGCKVAGFLAVFSSESAIFLLTLAAVERSLSAREMLKNGKSNHLRQ
FQAAAALAVLCAAVAGCLPLFHRGQYSASPLCLPFPTGDSASLGFTVTLVLLNSLAFLLM
AIIYTKLYCNLEKEDLSEHSQASTIKHIAWLIFTNCIFFCPVAFFSFAPLITAISVSPEI
MKSVTLIFFPLPACLNPVLYVFFNPQFKEDWKRLRRHVSRKSGSVAVSISSQGGCVAQDF
YYDCSMYSHLQGNLTVCDCCESFLLTKPVSCKHLMKSHSCPALAVAPCQRPDGYWSDCGT
QSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNIPRVKD
Download sequence
Identical sequences F7FZM1
ENSMODP00000011803 ENSMODP00000011803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]