SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011883 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011883
Domain Number 1 Region: 42-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000721
Family V set domains (antibody variable domain-like) 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011883   Gene: ENSMODG00000009513   Transcript: ENSMODT00000012107
Sequence length 235
Comment pep:known_by_projection chromosome:BROADO5:1:716671874:716677051:1 gene:ENSMODG00000009513 transcript:ENSMODT00000012107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPRAVARALLPTSPALSFPEPLGAQEHVTFRMNPVEKRDAGQGRELKLQCETVNSSPTGC
SWLRLTPGAVVPTFLLYLSGSSQSVKVAPELDSRRFGGSRSSSSYFLTLKDFQKDDQGYY
YCVVARNSRLFFSPFVPVFMPVKATTAPAPRPKPTTPAATNSSIQNAAGSEKCKSFSNTS
VSLCFVYTEKNGLDFSCDLYIWMPLTGGCVVLLLALIITITIFRRSRRRVCQCPR
Download sequence
Identical sequences F7F964
13616.ENSMODP00000011883 ENSMODP00000011883 ENSMODP00000011886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]