SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012218 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012218
Domain Number 1 Region: 126-264
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000157
Family Second domain of FERM 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012218   Gene: ENSMODG00000009777   Transcript: ENSMODT00000012443
Sequence length 446
Comment pep:known_by_projection chromosome:BROADO5:8:13642575:13653452:-1 gene:ENSMODG00000009777 transcript:ENSMODT00000012443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGGEGGPGSGPAERSQRSSVSSVGTRVADILVYLMDDTVVPLAVENVASITAQDLHRSI
REALQLPDVAMEAFALWLISPLLEVQLKPKHQPYKVCRQWSDLLFRFTDAPEDDIAVDEP
SLQFRRNVFFPKRRELQVSSEDVLRLLYEEAKFNVLEVRYPCDAEDCEKLGALVCRLKLG
PYRQGQQTACAVKEKLDSFLPAHLCKRPHGLFTAFRSRGPRLVPGEQGLLSAYQEVKEEA
SGPEAELLARHYAYLHKCHELPYYGCAFFCGEVDKPAQGFLHRGGRKTVTVAINLEGVHV
IDTKEKHVLLGLRFQELSWDYTCSGEDEHVLWLEFDGESEGTPVNKLLKVYSKQAELMSG
LIEYCIELGLAKEPPPPPETKRHKLRRQSSVVCSRIQHLATIDYVDDGKEIKRVKPKRTT
SFFSRQLSLGPATYTAVQPADGLEQS
Download sequence
Identical sequences F6TF58
ENSMODP00000012218 ENSMODP00000012218 13616.ENSMODP00000012218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]