SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013441 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013441
Domain Number 1 Region: 265-555
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.01e-66
Family Tandem AAA-ATPase domain 0.00033
Further Details:      
 
Domain Number 2 Region: 29-119,209-366
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.95e-21
Family Tandem AAA-ATPase domain 0.0000947
Further Details:      
 
Domain Number 3 Region: 629-702
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000513
Family GUCT domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013441   Gene: ENSMODG00000010727   Transcript: ENSMODT00000013687
Sequence length 717
Comment pep:known_by_projection chromosome:BROADO5:Un:17933807:17953430:-1 gene:ENSMODG00000010727 transcript:ENSMODT00000013687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKLLSETEIESEAVMEAAEQTRKHKHKKDKKEKSKNDKLEKEPQEETEELDSPKPKKV
KRGEEVISPKPKKAKKKEQLPEDEEDSSPKPKKAKKKRGGASTDEVSPKAKKTKKKEVPS
ENESPLKPKKTKKKDREVNGDTGEKRPKLEKVKVSNGLSHSKQASDSEESSDEESHSEEE
QELSAEQKEGAFSNFPISEETIQLLKARGVTYLFPIQAKTFHHVSSGKDLIAQARTGTGK
TFSFAIPLVEKLQGDSQPRPRGRAPKILVLAPTRELSIQVSKDFSDITKKLTVACFYGGT
PYNGQIDLIRRGIDILVGTPGRIKDHLQNGRLDLTKVQHVVLDEVDQMLDMGFAEQVEEI
LTVAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSTYEQVDLIGKKTQKAAVTVEHLAI
NCHWSQRAAVIGDVIQVYSGSHGRTIIFCETKKEAQELSLNESIKQDAQSLHGDIPQKQR
EITLQGFRNGKFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGI
CICFYQKKEQHQLAQVERQAGITFKRVGVPSASEIIKASSKDAIRFLDSVPPAAINNFRQ
TAQKLIDEKGAVEALAAALAHISGATTVEQRSLINSDVIVGLATEAFCSSLLPRGDPSLS
RDSQPCLGTDGRLGVCFDVPAAEVKSFQDNWQDSRRWQLSVATERPELEQQPDEGRG
Download sequence
Identical sequences H9H6E8
ENSMODP00000013441 13616.ENSMODP00000013441 ENSMODP00000013441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]