SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013825 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013825
Domain Number 1 Region: 396-539
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 292-397
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-36
Family Second domain of FERM 0.00000112
Further Details:      
 
Domain Number 3 Region: 211-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.51e-25
Family First domain of FERM 0.00000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013825   Gene: ENSMODG00000011038   Transcript: ENSMODT00000014078
Sequence length 892
Comment pep:known_by_projection chromosome:BROADO5:4:368167834:368367964:1 gene:ENSMODG00000011038 transcript:ENSMODT00000014078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKGLVAEAENPQHQQQKEEGEGATNTGTQEAQLEESSQKAAEGINQSEQKQKASNGD
TPPHEDLSKNKERTSESRGLSRLFSSFLKRPKSQVSEDEGKEIELAKDKREGGQRETEFG
AGLDEEILLKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEEHGEDLDFETKEGEELEEG
SKVEVKKESLEPKTDKELKSSQKAVRRHRNMHCKVSLLDDTVYECVVEKHAKGQDLIKRV
CEHLNLLEEDYFGLAIWDNVTSKTWLDSAKEIKKQVHGAPWNFTFNVKFYPPDPAQLSED
ITRYYLCLQLRQDIVTGRLPCSFATLALLSSYTVQSELGDYDPELHGADYVSEFKLAPNQ
TKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSG
LLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEHEQYESTIGFKLPSYRAAKKLWKV
CVEHHTFFRLTSTETIPKSRFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRA
SRSLDGAGAVETPDRSPRPTSAPAIAQSHGPEVSFPGTSNGKKPSVSKVQKETLKVEIKK
EEVEPEQVEPEPTEEWKVEKTHIEVTPPTINGDQIQQPAEKTEDLIRMRKKKTKRLDGEN
IYIRHSNLMLEDLDKTQEEIRKHHASISELKKSFMESVPEPRPSEWDKRLSTHSPFRTLN
LNGQIPSGEGPPLVKTQTVTISDVANAGKSEIPTKDVPIVHTETKTITYEAAQTDEGNGD
LDPGVLLTAQTITSETTSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVGEVKN
QWGENPLIRNQSSSKHLLRTYHMPGTLLKSVENKAMGISGYKSKNVGPVLKD
Download sequence
Identical sequences F7F455
ENSMODP00000013825 ENSMODP00000013825 XP_007491559.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]