SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014123 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000014123
Domain Number - Region: 558-603
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00157
Family Spermadhesin, CUB domain 0.0065
Further Details:      
 
Domain Number - Region: 233-275
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00196
Family Spermadhesin, CUB domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014123   Gene: ENSMODG00000011288   Transcript: ENSMODT00000014383
Sequence length 840
Comment pep:known_by_projection chromosome:BROADO5:8:270105023:270179560:-1 gene:ENSMODG00000011288 transcript:ENSMODT00000014383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGRSHGGAALALLPLLVGLLPLGAVAQVGRNSGADFDIFLPRGNNITVLIKRGTLTFCN
IILQRKRLSSLTINPGERAIFSFDCPQPEKHFVLEVQKNIDCMSGSCPFGEVQLQPSRLP
ALNRTFIWNVKANPRVGLELQFSRPRLRQILPGDTCSDSVTYTISSSLEKTVVNIGTFCS
NGTVSRIKMQGGVKLELYLPWDQNRNFSGFNITNHSSIKRLCIIESVFEGEGSATLMSAN
YPKGFPEDELMSWQFVIPPHLRASVFFLNYTLSNCEKKEERVEYYIPGSHSNPEVFQLGD
QQPGNMAGNFNLSLQGCDQDSQNPGALRLLFKVLVQHLQNEGNKVYTVDLSKEKAMSMTI
EPRTFKMSRSFDRACLICEGPRKCNPNVTLTAGHKHEISFLCDDMTRLWINAEKTISCTD
IGYCTRKNYSLLVPSDIIQLPVELHDYAWKLLVPKDKISLQLTPTQKLQQHTHEKNCKTT
FSYVLSSAGQGQNLHFGSFCPGGAIEKIQVKTNISVVLRTYSPGFSNESFRQGMTVTFIH
SLKDEGVFTVTPDSKTKVYLRTPNWDRGLPPLTSVSWNISVPNHHVAHLTFSKDRMGVSC
ETGRAFMIIQEQKAKAEEIVSRDDEPLPKPKDLHHNFWVNISNCSPMNGKQLDLEFCVSL
TPKKMDMTVIILAAVGGGATLLFALGLLACYAKKMSKKKKVSKGPAVGIYNGNTNTQMPG
HVGKFQKGRKDNDSHVYAVIDDTMVYGHLLSGSNGSSTGPEVDVYRPFQGPMGDVPPSPP
PICSRVSTRKLHPEDPLPFLLPESDGEPYTFSHPKPVEVKENRDNDIPLLEKKELENIME
Download sequence
Identical sequences F6WZG5
ENSMODP00000014123 XP_007505125.1.35504 ENSMODP00000014123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]