SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014740 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014740
Domain Number 1 Region: 110-313
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.57e-20
Family Hypothetical protein TM0207 0.072
Further Details:      
 
Domain Number 2 Region: 22-122
Classification Level Classification E-value
Superfamily ISP domain 0.00000000000109
Family Rieske iron-sulfur protein (ISP) 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014740   Gene: ENSMODG00000011766   Transcript: ENSMODT00000015012
Sequence length 581
Comment pep:novel chromosome:BROADO5:3:313425045:313505945:1 gene:ENSMODG00000011766 transcript:ENSMODT00000015012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKEQSAEILLSLTPLEVVGLKQGINFRRNKSSGKNYILYKDQNCLRACKNVCKHQGGL
FIKDIEDLDGRSVRCTKHNWKLDVSTMKYINPPGSFCQDELVIEMDENNGLLLMELNPPN
PWDVDPCCPEDLAFGEVQVTYLTHACMDLKLGDKKMIFDPWLTGPAFARGWWLLHEPPSD
WLERLCQADLIYISHMHSDHLSYPTLKKLADRRPNIPIYVGNTERPVFWNLRQSGVPLTN
IHVVPFGIWQKVDQNLRFMILMDGVHPEMDTCIIVEYKGHKILNTVDCTQPNGGRLPEKV
DLMMSDFAGGASGFPMTFSGGKFTEEWKAQFIITERKKLLNYKAQLVKDLQPRIFCPFAG
YFVESHPSDKYIKETNIKNDPNELNNLIKKSSNVSTWTPKPGAVLDLGRMLKDPLDSKSI
INPPVGTKIYKDSWDFEQYLKTLNDAIEDEIFLHPSWIKEYFTWAGFKNYNLVIRMIETD
EDFNILPSGYNYLVDFLDLSFPTERPTRDHPYEEIRSRISVIRHVVKHGLLWDDLYIGFQ
TRLQRDPDIYHHLFWNHFQIKLPLTPPHWKSFLVRQRYTTP
Download sequence
Identical sequences F7CW19
ENSMODP00000014740 ENSMODP00000014740 XP_007487914.1.35504 XP_007487915.1.35504 XP_016287231.1.35504 XP_016287232.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]