SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015465 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015465
Domain Number 1 Region: 217-336
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 8-92
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000000017
Family DBL homology domain (DH-domain) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015465   Gene: ENSMODG00000012345   Transcript: ENSMODT00000015751
Sequence length 408
Comment pep:known_by_projection chromosome:BROADO5:6:279534055:279555218:1 gene:ENSMODG00000012345 transcript:ENSMODT00000015751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTSWNSFFFQAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLI
PLHEDLLSQLREVRKTDGSTEHVGPILVGWLVCVSVTDQGVSGNIDPGSKQIHRHRDSRK
TDSVQGLRQAPNLSLLPSIPLFRADEVLAELRCRLLPRGHSPREQPPGHSDCGHASRDPI
NIIQGIVAEINTKTGESECRYYKERLLYLEEGHKDCLIDSSRVLCCHGELKNNRGVKLHV
FLFQEVLVITRPVTHNEQLCYQLYRQPIPVKELLLDDLQDGEVRLGGSIRGAFTNTERIK
NFFRVSFRNGSQSQSHALQASDTFNKQQWLNCIRQAKETAVCAEGQAGLLGPREPSPPAA
PLAGEARPEQMDQSGSESDCSMDTSEVSLDCERMDSSGGSGKQVESNV
Download sequence
Identical sequences F7E239
ENSMODP00000015465 ENSMODP00000015465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]