SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015618 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015618
Domain Number 1 Region: 43-158
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.05e-27
Family Canonical RBD 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015618   Gene: ENSMODG00000012481   Transcript: ENSMODT00000015907
Sequence length 179
Comment pep:known_by_projection chromosome:BROADO5:3:487213807:487214343:1 gene:ENSMODG00000012481 transcript:ENSMODT00000015907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEWMPIAKEYDPLKAGSIDGTDEEPHDRAIWRAMLARYVPNKGVSGDPHLTLFVGRLNL
QTTEEKLKDVFSRYGDIRKLRLVRDVVTGFSKRYAFIEYKEERSLLKAYRDANGLVIDQH
EIFVDYELERILKGWIPRRLGGGFGGKKESGQLRFGGRDRPFRKPINLPVFKSDFYGEG
Download sequence
Identical sequences F6Q400
ENSMODP00000015618 ENSMODP00000015618 13616.ENSMODP00000015618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]