SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016232 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016232
Domain Number 1 Region: 86-340
Classification Level Classification E-value
Superfamily SET domain 9.48e-62
Family RuBisCo LSMT catalytic domain 0.00029
Further Details:      
 
Domain Number 2 Region: 344-519
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 4.05e-49
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016232   Gene: ENSMODG00000012975   Transcript: ENSMODT00000016532
Sequence length 602
Comment pep:known_by_projection chromosome:BROADO5:1:320032517:320119501:1 gene:ENSMODG00000012975 transcript:ENSMODT00000016532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSCQKMGKKSRVKTQKSGTGATATVSPKEMLNLISELLQKCSSPTPGPGKEWEEYVQI
RALVEKIRKKQKGLSVTFEGKREDYFPDLIKWAAANGASTDGFELVNFKEEGFGLRATRE
IKAEELFLWVPRKLLMTVESAKNSVLGALYSQDRILQAMGNITLAFHLLCERANPSSFWL
PYIQTLPSEYDTPLYFEEDEVQHLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPNANKL
PLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDD
RCECVALQDFNVGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMK
AEVLARAGIPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLIGEHAIDRIFTLGN
SEFPVSWDNEVKLWTFLEARASLLLKTYKTTIEEDKSFLATHDLTFHATMAIKLRLGEKE
ILEKAVKSAAANQEYYCKQMEEGTPLPKYEESNIALLENTVADSRLPIVLRNLEDEAEVQ
EDLKIEEAITDREVTENGFVNSENSIPNGTKSEIENLNQEENTRETEDAKESSPDSTNEV
KQ
Download sequence
Identical sequences F7DB85
ENSMODP00000016232 XP_007473665.1.35504 XP_007473666.1.35504 ENSMODP00000016232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]