SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016333 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016333
Domain Number 1 Region: 27-116
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-22
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 108-217
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000353
Family Fibronectin type III 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016333   Gene: ENSMODG00000013053   Transcript: ENSMODT00000016634
Sequence length 524
Comment pep:known_by_projection chromosome:BROADO5:4:360676618:360693446:-1 gene:ENSMODG00000013053 transcript:ENSMODT00000016634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSSLWAPLLLCLLRPAPGSPELALPQNVTLLSRNFRVYLTWLPGPNYPLNVTYVVHYQ
SFENETNWKKAKHCLRIAIRECDLTCLKHLDPFLKFKGRVRAVVQGTYSLWAESKYLEYF
IDVEPAPPILTWILTEKTLIVNATNELPSCAYLMNLKYKVEFWKEGSPNKTETQVRFHEM
AVINLPPASTGRYCLRARTVYVLTTPKYSEFTKPVCFLLGTSGTQDGILALVLLVFLPII
ILIFCMCFLKKVYFQKAKMPQSLDFPGYRWPVKILELTRQESFRDLFICPKTSLEQKRPC
AGSRGPSIAPPSEMEDHETEEESKEGDSEDSDDSGTFEAYLEIAPIKSLMIRMAKTKTET
QSLESLESLTHHPQGDFSPDTSDSKNESESFWKQSGVINYLIKDPLCEDGLALPPPVFMK
KSELVEESSKGDLSSRDSLVPLGPTSPGLVFIPEEPLVSLKTLIINMDRGTQDRSEEEEE
EEEEEEEEENCLMKDTSGGNEVEGPWSEYPKRPKVSDYQHYRLH
Download sequence
Identical sequences F7G0V4
ENSMODP00000016333 XP_001365104.2.35504 ENSMODP00000016333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]