SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016492 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016492
Domain Number 1 Region: 30-153
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.44e-28
Family Hormone receptor domain 0.0015
Further Details:      
 
Domain Number 2 Region: 128-423
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000375
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016492   Gene: ENSMODG00000013178   Transcript: ENSMODT00000016796
Sequence length 464
Comment pep:known_by_projection chromosome:BROADO5:2:279880769:279954030:1 gene:ENSMODG00000013178 transcript:ENSMODT00000016796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPVPLRLTLLLLGAVGRAGPRPQGAYMSLSETVQKWREYQQECQRLIQEIPLPTTGG
TFCNRTFDSYACWPDGLPGTYVNVSCPWYLPWASSVHQGHVYRFCTTEGRWLYEKNSSLP
WIDVSECEENKTGERSHPEEQLLSFSIVYTVGHALSFSALVIATAILLRFRHLHCTRNYI
HLNLFMSFILRAMSIFIKDDVLKWMYSTATRSHQWEGLLSYQESLSCRLVFLMMQYCVAA
NYYWLLVEGIYLYTLLVLSVFSERRVFRLYVCIGWGIPLLFVIPWGIVKYLYEDEGCWSR
NSNMNYWLIIRLPILMAIGVNFFIFIRVICIIISKLKANLMCKTDTKCRLAKSTLTLIPL
LGTHEVIFAFVMDEHARGTLRYIKLVYQLFFTSFQGLMVAILYCFINNEVQLEFRKTWER
WRLEHLYTQRDCSMKPLKCPASSLSSGGTVGSSLYAATCQATCS
Download sequence
Identical sequences F6ZL39
XP_007483896.1.35504 ENSMODP00000016492 13616.ENSMODP00000016492 ENSMODP00000016492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]