SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016597 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016597
Domain Number 1 Region: 28-122
Classification Level Classification E-value
Superfamily Immunoglobulin 2.72e-23
Family I set domains 0.0014
Further Details:      
 
Domain Number 2 Region: 132-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000526
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016597   Gene: ENSMODG00000002517   Transcript: ENSMODT00000016902
Sequence length 163
Comment pep:novel chromosome:BROADO5:4:408451675:408453483:1 gene:ENSMODG00000002517 transcript:ENSMODT00000016902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPALSVLLCLEGGSPGPNSSPSLPDGLPRPSLRAENGSVVPQGGAVTLRCRGSWEAVEW
RLEKRGGSGWSLIKAVRQAGNEGEFSLPSVTSHDAGTYRCLYRHSSYRWSDRSDPLELVV
TGSPLPPPQASLPRPSWGALPSSEVASGQNVTLQCWSEPYHDG
Download sequence
Identical sequences F7D9H5
ENSMODP00000016597 ENSMODP00000016597 13616.ENSMODP00000016597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]