SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017831 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017831
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-26
Family C1 set domains (antibody constant domain-like) 0.00025
Further Details:      
 
Domain Number 2 Region: 341-431
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-26
Family C1 set domains (antibody constant domain-like) 0.00033
Further Details:      
 
Domain Number 3 Region: 239-324
Classification Level Classification E-value
Superfamily Immunoglobulin 8.13e-26
Family C1 set domains (antibody constant domain-like) 0.00063
Further Details:      
 
Domain Number 4 Region: 452-538
Classification Level Classification E-value
Superfamily Immunoglobulin 3.88e-25
Family C1 set domains (antibody constant domain-like) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017831   Gene: ENSMODG00000014242   Transcript: ENSMODT00000018160
Sequence length 539
Comment pep:novel chromosome:BROADO5:3:527545069:527571807:1 gene:ENSMODG00000014242 transcript:ENSMODT00000018160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REQEGGMVTKTTASEAAPRHSGDKFCQGASLRIWGIEKRKEAGERRQHKTKVGNSGQPKA
SPMVMAYGPSQDELRSPTATLTCLISGFYPGTLGVTWTKNGSPVSSGVLTSQPVRQTDNK
YSASSYLSVNPNQWGENNQYICKVTHEGQLCPRRNEQVILAGNILKSWTHPLDVPWEASS
TGIIWSNKMSAEVLAVEASLHSHGLLPQLSDEREGPDQCYVFGGGTKLIIEGLPKASPMV
MTYGPSQDELRTPTVTLTCLISGFYPRSLDVAWTKNGSPVSSGVLTSQPVRQTDNKYSAS
SYLSVNSNQWGREDIFICKVTHEGQCFVFGRGTRLTVTGQPKASPMVMAYGPSQDELRTP
TATLTCLISGFYPESLDVAWTKNGSPVSNGVLTSRPVRQTDNKYSASSYLSVNPNQWGEN
NQYICKVTHEGQCAVFGGGTRLTVTGQPKASPMVMAYGPSQDELRTPTATLTCLINDFYP
GSLDVAWTKNGSPVSSGVLTSRPVRQTDNKYSASSYLSVNSNQWGREDIFICKVTHEGQ
Download sequence
Identical sequences F6X1R6
13616.ENSMODP00000017831 ENSMODP00000017831 ENSMODP00000017831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]