SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017916 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017916
Domain Number 1 Region: 340-544
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-55
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 527-665
Classification Level Classification E-value
Superfamily PH domain-like 5.14e-30
Family Pleckstrin-homology domain (PH domain) 0.0024
Further Details:      
 
Domain Number 3 Region: 638-678,721-777
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.28e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 
Domain Number 4 Region: 808-903
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-16
Family Pleckstrin-homology domain (PH domain) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017916   Gene: ENSMODG00000014333   Transcript: ENSMODT00000018246
Sequence length 920
Comment pep:known_by_projection chromosome:BROADO5:6:194711923:194931719:-1 gene:ENSMODG00000014333 transcript:ENSMODT00000018246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRRAGGAMEAEDHSSVPAPVSAPVPGESHSDSSSAPETEGQLQSLSPLQCAPQPGKRPQ
IKCPAAKTHPPKKPRVPPKPVHFKPLGQERDSQRIPPAPRRPLPADPRPSRTLLTTEGET
HISPDISSLIEKFESIWHPIPVLQRSQSHLPFRMESSLNSSPSPNTADYELAFGSGDLSE
KNNKRDGSQPDVLGIAEPSSVDVGKLRELHIGDSQSFEDHSAAKPSKEAIGGDGAKASAV
EQGSNGKIPNRDSGIDSPSCSVAGETFPTEEGGENKKYPSPGLLIEMEPEGEQSMSSPGD
PQKEIAPEADSDVDEGSSEEPETADVPKGEDLDVAKCTEPQKLFNIANELLHTEEAYVKR
LHLLDQVVFCTKLAEAGIPSEVTTGIFSNISSIYCFHGQFLLPELQTRITQEWSTNPRIG
DILQKLAPFLKMYGEYVKNFDRAMDMVNTWTQRSSPFKDVVQSIQKQEVCGNLTLQHHML
EPVQRIPRYEMLLKDYLKKLPGESPDRKDAEKSLELISTAANHSNAAIRKMEKMHKLLEV
YERLGGEEDIVNPANELIKEGHIQKLSAKNGTAQDRYLFLFNSMLLYCVPKLRLIGQKFS
VREKMDIAGLQVQEIAKPNATHTFTITGKKRSLDLQTRTEEEKKDWIEVILATIEKHKQK
SETFRAFNSSFAQEEDVPDSPVIPPKLSPSLKLERGGSLHIGLMGGICRPSLDSRKSKNR
RDKEKQTCKSCSETFNSITKRRHHCKQCGAVICGKCSEFKADNSRQSRVCKECFLMQTTV
LNSPVPEPSGEQRKKLEKHNITAPENSLFCSHLQLIDKGKVCCKLWATIPKAEPLVLYLQ
GGQDGRAPRTIPLPGYEVTLPGPAEKLEAKYTLKLSQSQQTLYLSVEDEELQRKWMEVLT
RAAKGETDDPSASIGNPQGP
Download sequence
Identical sequences F6UMD4
ENSMODP00000017916 ENSMODP00000017916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]