SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017977 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017977
Domain Number 1 Region: 86-545
Classification Level Classification E-value
Superfamily Sema domain 3.53e-118
Family Sema domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1713-1840,2028-2214
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-46
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1178-1273
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000327
Family Other IPT/TIG domains 0.0082
Further Details:      
 
Domain Number 4 Region: 1270-1362
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000798
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 5 Region: 548-599
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000667
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1359-1404,1438-1491
Classification Level Classification E-value
Superfamily E set domains 0.0000000000229
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017977
Domain Number - Region: 1505-1560
Classification Level Classification E-value
Superfamily E set domains 0.0021
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 
Domain Number - Region: 703-733
Classification Level Classification E-value
Superfamily Plexin repeat 0.0116
Family Plexin repeat 0.0087
Further Details:      
 
Domain Number - Region: 1139-1173
Classification Level Classification E-value
Superfamily Plexin repeat 0.0628
Family Plexin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017977   Gene: ENSMODG00000014384   Transcript: ENSMODT00000018308
Sequence length 2247
Comment pep:known_by_projection chromosome:BROADO5:6:194134565:194207282:-1 gene:ENSMODG00000014384 transcript:ENSMODT00000018308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGAALDLPCPGFPLTPPTGFSTGPLSPTPHDPGLGDLIHTGHAAVCLLCVLYQVTMLIL
GSALLQLLWAVCAPASTMQQTTLASFTPNSTRLQHLVRDPTSGTLYLGATNFLFQLSSEL
KLEAAVSTGPVLDSRDCLPPVLPLECPQAQPTDNPNQLLLVSPGGPGRDEGALVVCGSAH
QGVCEQRRLDHIGQLLLRPERPGDTQYVAANDPAISTVGLVGQGPAGEPLLFVGRGYTSR
GVGGGIPPITTRALRPPDPQAAFSYEETAKLAVGRLSEYSHHFVAAFARRTSVYFLFLRR
DLQAQSRAFRPYLSRVCLSDQHYYSYVELPLSCGGTPYGLVQAAAVAVPGTGSQGDGGEV
LFAAFSSVNPSATGRAPAAGASGASALCAFPLDKVDQLANRTRDACYTRDGRAEDGTEIA
YIEYDVNSNCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPLVEWADVQLTAVAVSVED
GHTIAFLGDSQGQLHKVYLGPEGDHRPYATQLIQRDSAVSSDLIFDWALEHLYVMTQSTV
VRVPVASCSQHLNCTSCLAPKDPYCGWCVLLGRCSRRAECSRGRGPEPWLWSFSSEPKCL
QIQDVSPANVSREEKRNIFLSISDLPVLRPDESYSCYFEDYESPAVRTDAGVMCPSPDPS
RTPALQMDADHVLVPLLLKFGDVVIASTEFSFYDCAAVAMLHLSTPCQACVQSTWGCSWC
VWQHLCTHKTTCEGGPIVHSQRPPLSASWPLLSSVAPTGDVHTFLPSVPPKSSVTPVPKL
PPTEPGTPLVALSSPSTDIMPPPTEEAPRTPPPELGIPLTVPMPTTIAPPTTEAFAFMPS
TVGSKVTLSPALEIAPTEEPSHLPSISVDSGSMEGVGDIVTLVDVPGAVTELEDLLPPAP
SPSPLGDTAVLTSSSWDLGTLALSSSPHWDQAPSAGPSTTFPGVAGSEEHAPDWLLTEDE
LPEADEWTGSDASPFSTSTLLSGDGDSSEFEGPNAPHILLPDLDYQYDSPGLWELEEVIN
QGPAACPCVEGIEGSSLLPVQIGRELTLLGRNFHLYQDGLGDYECVLELEGNMEVTEARV
ECDGVSGTLCRIICQLHQLSYEAPQPEFHVPVFLRKSGRLRVDSAEGLHVTLYDCSVGRP
DCSLCRTADPRYSCVWCDGEHPHCAAREACAETEAALCPAPLIHMVEPLTGPVDGGTRIT
IRGSNLGQKHQDIAETVTVAGVPCAVDAQEYEVSSSIVCVTGGSGEEKVGHVTVEVPGGG
HGISDHKFAYQDPEVRSIFPVRGPKAGGTCLTLQGSKLLTGRLEDIRVLVGDHPCQLFSV
AQMEQLQCQTSPSPVPAALQVAVWFGGVGRQLQQGLFQYTPDPNITSAGPAKSFVSGGRV
IWVHGQNLDVVQTPRIRVTVSTQEQHQRQRRGLGRRRRIVPETVTECPPDVPCSTQHFEE
PCHINSSHLLVCRTPAIPGLLGGTWVQLEFVLDNLLFDFATLHPTRFSYEANPILKPLNM
EDPSSPFRHKPGSVLSVEGENLDLAISKEEVVAMIGDGPCLVKTLTRNHLYCEPPVEQPP
PRHREGLNSLPEFTVQMGNLNFTLGRVQYDIESPLAFPVGAQVGLGVGASLLALGVLIIV
FIYRRKSKQALRDYKKVQIQLENLETSVRDRCKKEFTDLMTEMTDLTSDLVGSGIPFLDY
KSYAERVFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRT
FSPRDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTETVVEKLLT
NWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDLEYRP
LTLNAVAVPGVGLAEAPGVPVKVLDCDTISQAKEKILDQLYKGAPLAQRPDPGALDVEWR
SGVAGHLILSDEDVTSVVQGAWRRLNTLQHYKVPDGATVALVPRFSKHIPRENQDYVPGE
KTPMLEDMDEGGIRPWHLVKPSEEPEPPRQRRGSLRGGDRERAKAIPEIYLTRLLSMKGT
LQTFVDDLFQVILSTSRPVPLAIKYFFDLLDDQAQQHGISDQDTIHIWKTNSLPLRFWIN
IIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYARDIPRYKQM
VERYYADIRQTISASDQEMNSALAELSRNYSGDLSALVALHELYKYINKYYDQIITALEE
DGTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences F6T7S8
ENSMODP00000017977 ENSMODP00000017977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]