SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019196 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019196
Domain Number 1 Region: 837-1117
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-72
Family Protein kinases, catalytic subunit 0.00000429
Further Details:      
 
Domain Number 2 Region: 521-812
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.33e-47
Family Protein kinases, catalytic subunit 0.0000758
Further Details:      
 
Domain Number 3 Region: 369-498
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-19
Family SH2 domain 0.003
Further Details:      
 
Domain Number 4 Region: 277-384
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-16
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 5 Region: 139-259
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000576
Family Second domain of FERM 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019196   Gene: ENSMODG00000015373   Transcript: ENSMODT00000019543
Sequence length 1130
Comment pep:known_by_projection chromosome:BROADO5:6:166784920:166909591:1 gene:ENSMODG00000015373 transcript:ENSMODT00000019543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLTMTEMEGSATSSTHQNGDIPGNEDTLKQTEPVLQVYLYHSLGKTEGDYLRFPIGEY
IAEEICIAACKACGITPVYHNMFALMSEAERIWYPPNHVFHVDEATRYNVLYRIRFYFPH
WYCNGSNRTYRYGISRGTETPLLDDFVMSYLFAQWREDFVHGWIKVPVTHETQEECLGMA
VLDIMRIAKENDQTPLAVYNSTSYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIQQFSQ
CKATARNLKLKYLINLETLQSAFYSEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSRGK
HKDSETLTEQDLQMYCDFPDIIDVSIKQANQEGSNENRVVTIHKQDGKNLEIEFHSLREA
LSFVSLIDGYYRLIADAHHYLCKEVAPPTVLENIQSNCHGPISMDFATSKLKKAGNQTGL
YVLRRSPKDFNTYFLTFAIERESTTDYKHCLITKNENGEFNLSGTKKNFTNLKDLLNCYQ
METVRSDSIIFQFTKCCPPKPKDKSNLLVFRSNGISDVPTSPTLQRHNNVNQMVFHKIRN
EDLIFNESLGQGTFTKIFKGVRREIGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMS
QLSYKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWAMH
FLEEKSLTHGNVCTKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPE
CIENAKNLSLAADKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTELAN
LINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRNGALGFSYAFEDRDPT
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEIL
KSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERLDHKKLLQYTSQICK
GMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYA
PESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELL
KNNGRLPRPDGCPDEIYSIMTECWNNNVSLRPAFRDLALRVDQIRDDMGG
Download sequence
Identical sequences F6WH53
ENSMODP00000019196 ENSMODP00000019196 XP_007499600.1.35504 XP_007499601.1.35504 XP_016279730.1.35504 XP_016279731.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]