SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019482 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019482
Domain Number 1 Region: 282-526
Classification Level Classification E-value
Superfamily SIS domain 0.00000000000000512
Family mono-SIS domain 0.017
Further Details:      
 
Domain Number 2 Region: 29-183
Classification Level Classification E-value
Superfamily SIS domain 0.000000717
Family mono-SIS domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019482   Gene: ENSMODG00000015608   Transcript: ENSMODT00000019831
Sequence length 623
Comment pep:known_by_projection chromosome:BROADO5:1:508848619:508873322:1 gene:ENSMODG00000015608 transcript:ENSMODT00000019831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGKWELSEYEASLPITEKSNPLTKDLDKANAEQIVQLLGQCDAEI
FQEEGSAMPAYQGDRLESTSPIISLIKPCDQSTETLNDPEGGLVVLSGGGTSGRMAFLMS
VSFNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGI
SVGLSAPFVAGQMDFCMSNPDIFLPVLVGFNPINMARNDPIEDWNSTFREIAEKMQKLQE
KQKAFVLNPAIGPEGLSGSSRMKGGSATKVLLETLLLAAHKTVDRGIAASQSCLLEILRT
FERAHKVTYSQGTKIAALMKQASTRLLSKGRVYLVGWQTLGIIAIMDGLTFKTYFQDVRG
FLIGDHSDMFNRKEELIDQGPQFSFSQEDFLSSILPSLTEIDTVLFIFTLDDNLTEVETL
VEQVKKKTPNIQALAHSTVGQYLPSPLKKLFPSIISITWPLLFFEYEGNFIQKFQRELST
KWVLNTVSTGAHVLRGKILYNHMLDLRLRNSKLFWRGLAMLQRFSGQPKAQCIKSLLKAI
HFPQEVSEEIQAAPISYHIQVAHEKEQVIPTALLTLLFRCSIPEAKTHLTASPSVCETIK
NILLRLGRKRSADSIDTLKMTIE
Download sequence
Identical sequences F6Z550
ENSMODP00000019482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]