SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020457 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020457
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000959
Family Complement control module/SCR domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020457   Gene: ENSMODG00000016370   Transcript: ENSMODT00000020817
Sequence length 107
Comment pep:novel chromosome:BROADO5:8:159135994:159136314:1 gene:ENSMODG00000016370 transcript:ENSMODT00000020817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSQASPPQGGTFQVIASSGTTLGTIMMFHCPIGHQMQGQCIVTCIWRENGTECTNGTLTC
KALPIYETFGFKVAVIASIISCAIIPLMSVAFLTCCLFKCVKKNEWR
Download sequence
Identical sequences F7ERR3
ENSMODP00000020457 ENSMODP00000020457 13616.ENSMODP00000020457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]