SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021106 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021106
Domain Number 1 Region: 236-385
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 126-235
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-24
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 40-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.05e-21
Family First domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021106   Gene: ENSMODG00000016916   Transcript: ENSMODT00000021478
Sequence length 1052
Comment pep:known_by_projection chromosome:BROADO5:8:137997110:138329952:-1 gene:ENSMODG00000016916 transcript:ENSMODT00000021478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIVLKKAWFLTSFPICIYFDLRGKKCKDLEEPGHSRMTEGRRCQVHLLDDRKLELLVQP
KLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWLQLDRRVLEHDFPKKSGPVVLYFC
VRFYIESISYLKDNATIELFFLNAKSCIYKELIEVDSEVVFELASYILQEAKGDFSSNEI
VRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKLNGQTRGQAIVNYMSIVESLPTYGV
HYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIFQWRQLENLYFREKKFSVEVHDPR
RASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQHQFYLDRKQSKSKIHAARSLSEIA
IDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKSRQEAL
EETLRQRLEELKKLCLREAELTGKLPREYPLDPGEEPPIVRRRIGTAFKLDEQKILPKGE
EAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQRKTSYLNALKKLQEIENAINDNR
IKSGKKPTQRASLIIDDGNIASEDSSLSDALVLEDEDSQVTSTISPLQSPHKGLPPRPPS
HNRPPPPQSLEGLRQMHYHRNDYDKSPIKPKMWSESSLDEPYEKVKKRSSHSHSSSHKRF
PSTGSCAEAGGSNSLQNSPIRGLPHWNSQSSMPSTPDLRVRSPHYVHSTRSVDISPTRLH
SLALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRTRSSNGSDPMDDCSSCTSHSSSEHY
YPAQMNPNYSTLAEDSPSKARERQRQRHKSAGNLVSSNSGSMPNLAARNGTGHHGVYLHS
QSQPSSQYRIKEYPLYIEGSSTPVVVRSLENDQEGHYSVKAQFKTSNSYTAGGMFKENWH
GDEGDSVRLTPSRSQIIRTPSLGREGHHEKSSGRTVVSDELRLWYQRSTASHKEHSRLSH
TSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSAALPHSQRSSTPSSEIGATPPSS
PHHILTWQSGEATENSPTMDESESPTHQSTDE
Download sequence
Identical sequences F6VN95
ENSMODP00000021106 ENSMODP00000021106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]