SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021185 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021185
Domain Number 1 Region: 232-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000104
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000171
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021185   Gene: ENSMODG00000016981   Transcript: ENSMODT00000021558
Sequence length 610
Comment pep:known_by_projection chromosome:BROADO5:2:190765401:190783943:-1 gene:ENSMODG00000016981 transcript:ENSMODT00000021558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGSAAHPGGGGRRSKWDQPAPAPLLFLPPAAPGGEIPNSGGSPGGSAAAPSGALDAAA
AVAAKINAMLMAKGKLKPTQNAVEKLQVPGKGLVSSKSKDDLVVAEVEINDVPLTCRNLL
TRGQTQDEISRLSGAAVSTRGRFMTAEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKE
IITNGVVKAATGTSPTFNGATVTVYHQPAPVAQLSPAIGQKPPFQSGLHYVQDKLFVGLE
HAVPTFNVKEKVEGPSCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHP
KPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYTQPSAINSVPPQPPYYPSNGY
QSGYPVVPPPQQPVQPPYGVPGIVPPAVSLAPGVLPTLPTGVPPVPTQYPISQVQPPAST
GQSPMSGPFLPAAPVKTALPTSPQPQPPLPAQSQGQKRRFTEELPDERESGLLGYQHGPI
HMTNLGTGFSSQSEIEGAGSKPASSSGKERERDRQLMPPPAFPVTGIKTESDERNGSGAL
SGSHDYPAKKMKTTEKGFGLVAYAGDSSDEEEEHGGHKNASTFPQGWSLGYQYPSSQHRA
KQQMPFWMAP
Download sequence
Identical sequences F6UL87
ENSMODP00000021185 ENSMODP00000021185 XP_001367095.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]