SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021266 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021266
Domain Number 1 Region: 62-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000123
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 716-771
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000268
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 480-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000274
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 4 Region: 624-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000205
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 533-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000219
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 779-804
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000827
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 577-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000019
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000021266
Domain Number - Region: 145-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00155
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021266   Gene: ENSMODG00000017043   Transcript: ENSMODT00000021640
Sequence length 887
Comment pep:known_by_projection chromosome:BROADO5:1:472730579:472752073:1 gene:ENSMODG00000017043 transcript:ENSMODT00000021640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKDGERIESQLPAPHEPPKLGKNTLHRDHSPPFPSSIILASASFTGNSTSDKMEGRKKGR
PKVENQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQGELGAA
LSLVKPSAVRLNCSHDPIIPRHMWFSLLFLLQGAISEKLTYPCPYCEAAFTSKTQLEKHR
LWNHMDQPVPASRPFPLPKAPVQVPKSVPVGKLVQVSKPIQVGKPVPVSKPVPVTKVAPV
SKPIPLTKPVPVTKLVSVSKPVLPTKLIPVSKPFLPSKPFPSSKPIQINKPFPSSKPVLV
SKPIPISKSASPSKVLPMNKPEGKVQRTVGRSGGKKRAAEGLDTCPVHPKQAKLEKEGDL
HPENGECALDTCESKDFHMTAAEAIASPTTKATSSKEATVPVSPPEEDPERSKHRRKQKT
PKKFTGEQPSISGTFGLKGLAKAEDKAKAHRAKKLEASSSAEEGRKKVLTANVKKEVVPI
PTAHLSTGDPEEQWQRILHEKGEVVCPTCGVITRKTIVGLKKHMDVCQKLQDALKCQHCK
KQFKSKAGLNYHTMAEHSSKPLTDVEPTEVDEQEERERLRKVLKQMGKLKCPNEGCAAAF
SSLMGYQYHQRRCGKQPCDLESPVFTCPHCGKTYKSKAGHDYHIRSEHPTPPPEEPVGKP
PEPDVEMNMERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETKRLNYT
RPGLPTLNPQLLETWKNEVKERGHVNCPNNCCEAIYSSVSGLKAHLANCTKGDHLVGKYR
CLLCQKEFSSESGVKYHIIKTHSENWFRTSADSPPKPKSKEQLSAKEKKNSTSSGKKRGR
KPKERPSEGPPPKTSPKPQDDWPLGGRDKGNRVVPSRKSGASKVPEK
Download sequence
Identical sequences F6XZT5
ENSMODP00000021266 13616.ENSMODP00000021266 ENSMODP00000021266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]