SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022187 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000022187
Domain Number - Region: 299-323
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0123
Family CCCH zinc finger 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022187   Gene: ENSMODG00000017794   Transcript: ENSMODT00000022576
Sequence length 622
Comment pep:known_by_projection chromosome:BROADO5:4:420919344:420994401:1 gene:ENSMODG00000017794 transcript:ENSMODT00000022576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSYRCGTKGRSQGCGTVGLWGRSGSPHNRTGMVAPELGQPEVVDDTELQMKVDFFRKLG
YSSGEIHGVLHKLGLQADTNTVLGELVKHGPATDRETPLDGPPEPPLVPRGGGTPKVPSS
CSLPTEDKEVSNLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHSDITVFVPLW
RKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAFESDGIIVS
NDTYRDLQCERLEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPLVLEHK
KQPCPYGKKCTYGIKCRFYHPERPSRPQRSVADELRANARLSPPRAPAKDQKCRQPSPTS
TPAPGSLPVKNDRECWLPEKFLGPQQASGGNGDGQTKAYAQGRSLPTVSGGFGPADWGPP
PLDSLSYLSQDCLDSGIGSLESQMSDLWGGRGSSHGESGEPSRTGGSGSNPQRCTFLGRG
PLLTYGPEPPAGPSSVSFSGYGRPVGTGQFSIPAEYPPPLGYAPREYWSEPYPMPPPTAT
RAPPALQDPHLLSAPAAYGAEAAAWGAGTDSFTKERASLRVKLCGIFPPHLVEAVMSRFP
QLLDPLQLAAEILNYKSQNPSG
Download sequence
Identical sequences F7CZ87
13616.ENSMODP00000022187 ENSMODP00000022187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]