SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023090 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023090
Domain Number 1 Region: 4-57
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000181
Family Complement control module/SCR domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023090   Gene: ENSMODG00000018517   Transcript: ENSMODT00000023502
Sequence length 100
Comment pep:known_by_projection chromosome:BROADO5:8:122166901:122170867:-1 gene:ENSMODG00000018517 transcript:ENSMODT00000023502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPTPRSSYNVNSRERYVCHSGFKRKAGTSSLTECILEQNSNIAHWTEPNLKCIRDPSLVH
QKPPSSTMSTKELLTSSEKEPEASTSPKSDTTVTTETVMV
Download sequence
Identical sequences F7AGD4
ENSMODP00000023090 13616.ENSMODP00000023090 ENSMODP00000023090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]