SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023145 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023145
Domain Number 1 Region: 743-873
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.48e-31
Family Synaptotagmin-like (S variant) 0.00000216
Further Details:      
 
Domain Number 2 Region: 28-70,111-191
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.27e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0084
Further Details:      
 
Domain Number 3 Region: 1454-1573
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.1e-23
Family Synaptotagmin-like (S variant) 0.0085
Further Details:      
 
Domain Number 4 Region: 580-705
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023145   Gene: ENSMODG00000018557   Transcript: ENSMODT00000023558
Sequence length 1602
Comment pep:known_by_projection chromosome:BROADO5:2:323441084:324181477:1 gene:ENSMODG00000018557 transcript:ENSMODT00000023558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSSALGPRGPRPPTVPPPMQELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVV
RDMAKPAARKAPRNAENQSHQPSPRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGI
CLKTKFADGCGHLCSYCRTKFCARCGGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGAW
FFGSGPQPPSQDGTLSDTATGAGSEVPREKKARLQERSRSQTPLSTAAASQEITPSGVPP
ERSKGTELSQKTMGLEQKQISSRSRSEPPRERKKTSVTGEQNGKAGLKSERKRVPKSSLQ
QGEGLVEERDRKERREGRRLEKVRSQDLPEKREEGKGVEDEKQRKEEDYQTRYRSDPNLA
RYPVKPHPEEQQMRMHAKVSKARHERRHSDVSLPHTEMEESEVLENKLGKRAQPSGAQDR
KSLLETQRSYSIERTGDVRISVSKQLTNHSPPATRHGPVPTEHPESKNQDSFKKQSRLDP
SSAILIRKAKREKMETMLRNDSLSSDQSESVRPSPPKPHRSKRGGKKRQMSVSSSEEEGA
STPEYTSCEDVEIESESVSEKGDLDYYWLDPTTWPSRETSPISSHPVTWQPSKEGDRLIG
RVILNKRTTMPKESGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLE
WNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQK
MERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPPRVDGRPR
NPYVKMYFLPDRSDKSKRRTKTVKKVLEPKWNQTFLYSHVHRRDFRERMLEITVWDQPRV
QEEESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKKL
QRSQRIIDSDISDYEVDDGIGVVPPVGYRSNTRESKSTTLTVPEQQRTAHHRSRSVSPHR
GDDQGRPRSRLPNVPLQRSLDEIHQVRRSRSPTRHHDASRSPVDHRSRDMDSQYLSEQES
ELLMLPRAKRGRSAECLHTTSELQPSLDRARSASTNCLRPDTSLHSPERERQSRKSERSS
NQKQTRKSNASDAERVLPQHLSRRGHPTPRTTDQPVIRGKHPSRSRSSEHSSIRTMCSIH
HLAPGGSAPASPLLTRIHQQGSPGQSPPADTAFSNRRGRQLPQVPIRSGSIEQASLVVEE
RTRQMKMKVHRYKQTTGSGSSQELDREQYSKYNIHKDQYRSCDNVSAKSSDSDVSDVSAI
SRTSSASRLSSTSFMSEQSERPRGRISSFTPKMQGRRMGTSGRTITKSTSVSGEMYKLEH
NDGSQSDTAVGTVGTGGKKRRSSLSAKVVAIVSRRSRSTSQLSQTESGHKKLKSTIQRST
ETGMAAEMRKMVRQPSRESTDGSINSYSSEGNLIFPGVRLGADSQFSDFLDGLGPAQLVG
RQTLATPAMGDIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAK
KKTRIARKTLDPLYQQSLVFDESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEDLDLSS
MVIGWYKLFPPSSLVDPTLAPLTRRASQSSLESSTGPPCIRS
Download sequence
Identical sequences F7G2H7
ENSMODP00000023145 XP_007484243.1.35504 ENSMODP00000023145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]