SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023234 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023234
Domain Number 1 Region: 1850-2067
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-61
Family DBL homology domain (DH-domain) 0.0000000683
Further Details:      
 
Domain Number 2 Region: 2052-2207
Classification Level Classification E-value
Superfamily PH domain-like 4.02e-50
Family Pleckstrin-homology domain (PH domain) 0.00000122
Further Details:      
 
Domain Number 3 Region: 1754-1878
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-23
Family SH3-domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023234   Gene: ENSMODG00000018631   Transcript: ENSMODT00000023648
Sequence length 2279
Comment pep:known_by_projection chromosome:BROADO5:4:105441255:105955037:1 gene:ENSMODG00000018631 transcript:ENSMODT00000023648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPRSPRLAMEEGLRRLEEEEEDGNSSNVVRQELDWLQLYLSPLPDSYMKAKFTLSAYL
ACWLILKLCKKAYEQRSHSSKKICLSCLNLSPEPSVTSPTDCMASQTTPEPVEPSPGDLE
LEDTQLLSSTVDLEKQRLSQETDEDYFETQSHQSECPSEVKTEPFESASDTDSLPSDIPA
ETCSGSQLLACEKEAACNGSSDVGAASSLQEFHLVNAQRLGGEQQVDFPPDLKGSAGKSE
LLISSSGTGKGQTKETEPSRLGQDLQLPFESPLVTIPLRTKIGSEGSKEDSSCQPAKEVK
VKDSAGISDPLLEEPKSESFLSAAAPHLFPFWSCKWGRSLSDSLLEKKKRGSKGNKEKST
SRLWHGSVPHIDCPRRKLYDSETSLFSRTRKKIPETRKETDLPLYPFCLQLPHCTPVKTS
NLSWTKLWHSVPENIGSQSKGPSEHCCQCPSALRRNRSLASFSTGQPESSRRKHFVKFGS
LSKGAKKVDQALRIHIITSGACPDPVPSQLPHPPTTPQRGDTSPQGQPELHAFNLERGLP
VEDLKLKGWSGHDSEHRAQRNQCQISTYPTSESLSINAEELPGPTNCRSKHDRVAHELLR
GIDATSKAASVDDKQRHPVDISVKTGNQTSNYTARDIPNEKISLSPDLKQIEPQSPSHRS
NRDLMGCSGPNLSSDDPEKALKSSERDIAKEEVMVPDPSCGSCASGDYSEVTLLEVSTEE
EQNASGSVDKTTPPPAFQRPQAKSEKNPKGKASLIIIAVEQKGLQATRRKPNPANSVSEI
RPSGTLGSFQEETSESLSDASSALCGLNGAEEVETNGSEWRLHEPTVPESKEDSLGVNVP
GENTDWEQQVTEETTLEETQGPDADSKEEPLGRVDLLLEKTCPPGNDSSILGVESFHSGT
LRVHRDDGMNDHSEEELLVGSQDSEARLNTKQVDLAPEKEREHDICMNHLTDATQTSAGL
NLPDAALRDTTNAENISKGRGVERETEDFKPLSPRDDFPNSETNLSSILEEGEVGEHNSH
SLPMAKVFPSQEKNLDPNASELLDPGFGNINCEELEAPSNNVSVYKASPKGGKTGIAGRP
SRFLVFPKMTSFKKNKTSGAEHFLGSSTHPSKGKAEDVDVGKDDGVQQGFQAPNTDLLSM
ITLNKESSILEYSDEEMNEKRPFNRISLRRASGPGRIPLEDLDTSIPDTSVKCDREGEGE
KGGRLSLTDSSEAEMPEDSVPRRLSSESNELKRFKNTEKKIRTRFALAQKSFSNFFEPKG
LEKENTDQSSKGSLKTEKEKTKVRQSSWKTLLKGKESDGMRRPALASLAQSRLVLRSPSY
PLQGVSDEGGKLTQDREGQANEQTLLSVPYVPLQVPGSPMPVRDVASPDQRRKSEPVIKC
MTTRESGESLGGSLAVSPAEAWLKSPGTPSIHQILSFSSPCSPVYDSKDMPCKPMSPKPQ
SPRPNAQRRSFQYSGRVNAISMISLGNCYSTEGSPEAPERPKTLKPRATFLLSLHDLDQE
CQKEESGVSTLSQGSLATASSTHEALESKDPTFHNNTLSEGRPGEKLVCQYGKRVPPTGP
TQRPFSTIENVTWTFPFLSADRNPSETSCRTTTMSRNHYASLDDLWLEKQRKRKFKKQAH
LERGEHAGTLPKDLVKARMKMSVTSPVPLDILALKIQPISQSAPTCLDHKCWRERIPFSN
YSKCQRGAYQQLPRSQREQTVKGRDVNMFSETARVIPDGALEKSALADELGSEEDLYEDF
RSSTHHYGHPGGGGEQLAINELISDGSVVYAEALWDHVTMDDQELGFKAGDVIEVMDATN
KEWWWGRILDGEGWFPASFVRLRVNQDEPMEDYSAKAEDGKEADTGSISRRQGTAQSSKD
QMRTNVINEIISTEKDYIKHLKDICEGYIKQCRKRADMFTEEQLKTIFGNIEEIYKCQKK
FVKALEKKFNKDHPHLSELGSCFLEYQNDFQIYSEYCNNHPNACVELSKLAKVNKYVYFF
EACRLLQKMIDISLDGFLLTPVQKICKYPLQLAELLKYTNPQHRDFKDVEAALNAMKNVA
RLINERKRRLENIDKIAQWQSSIEDWEGEDVLARSSELIHSGELTRISQPQAKSQQRMFF
LFDHQLIYCKKDLLRRDILYYKGRIDMDDMEIVDLEDGKDKDFNISVKNAFKLHCSSTDE
SHLFCAKKPEQKLRWLKAFENERKQVQLDQETGFSITEVQKKQAMLNANKQQSSGKPKGE
LLFFFLPAVNRPYYDFLMRQKHPTLPANLPQQQVFMLAEPKRKPSNFWQNISRLTPFRK
Download sequence
Identical sequences F7B2M1
ENSMODP00000023234 ENSMODP00000023234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]