SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023407 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023407
Domain Number 1 Region: 159-434
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-86
Family Calponin-homology domain, CH-domain 0.000000915
Further Details:      
 
Domain Number 2 Region: 1723-1922
Classification Level Classification E-value
Superfamily Plakin repeat 1.57e-44
Family Plakin repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 1925-2110
Classification Level Classification E-value
Superfamily Plakin repeat 2.49e-38
Family Plakin repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 6703-6862
Classification Level Classification E-value
Superfamily Spectrin repeat 2.81e-27
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 449-566
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-27
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 6528-6646
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-26
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 7 Region: 6944-7080
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-26
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 5502-5658
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-25
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 9 Region: 6044-6197
Classification Level Classification E-value
Superfamily Spectrin repeat 3.19e-24
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 10 Region: 6285-6425
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-22
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 11 Region: 7074-7191
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-21
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 12 Region: 4732-4881
Classification Level Classification E-value
Superfamily Spectrin repeat 2.73e-21
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 13 Region: 7409-7488
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.8e-20
Family GAS2 domain 0.00059
Further Details:      
 
Domain Number 14 Region: 6863-6974
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 15 Region: 5063-5219
Classification Level Classification E-value
Superfamily Spectrin repeat 2.57e-19
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 16 Region: 4285-4425
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-19
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 17 Region: 5654-5769
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-18
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 18 Region: 6422-6536
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-17
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 19 Region: 5735-5876
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-16
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 20 Region: 7320-7400
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000175
Family Polcalcin 0.044
Further Details:      
 
Domain Number 21 Region: 884-986
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000259
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 22 Region: 5937-6062
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000895
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 23 Region: 1437-1547,1574-1602
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000124
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 24 Region: 6200-6314
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000245
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 25 Region: 4483-4603
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000161
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 26 Region: 4203-4316
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000183
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 27 Region: 4029-4152
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000267
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 28 Region: 5278-5438
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000326
Family Spectrin repeat 0.024
Further Details:      
 
Domain Number 29 Region: 4954-5075
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000138
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 30 Region: 4861-4966
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000471
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 31 Region: 4645-4748
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000331
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 791-883
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000144
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 33 Region: 959-1066,1187-1206
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000216
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 34 Region: 7200-7263
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000144
Family Spectrin repeat 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023407
Domain Number - Region: 3546-3625
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0017
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 1374-1469
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00208
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 1213-1354
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00445
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 3800-3912
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00849
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 3667-3785
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0633
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023407   Gene: ENSMODG00000018775   Transcript: ENSMODT00000023823
Sequence length 7704
Comment pep:known_by_projection chromosome:BROADO5:2:306764543:307378447:-1 gene:ENSMODG00000018775 transcript:ENSMODT00000023823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAAAFLVLLRPYSIQCALFLLLLLLGTIATILFFCCWHRRLQKGRHPMKSVFSGRSRSR
DAVMRSHHLRSEVIYLARTLKGFRASPRHTRRRVAARLEETEPLAEVHHQSEQETSVRKR
KLKKSSRVQPEFYHSVQVPSTRKASSGNASYRCSMSSSADFSDEDDFSQKSGSASPAPGD
TLPWNLPKHERSKRKIQGGSVLDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVN
DLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKKRQVKLVNIRNDD
ITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQTTEGYAGIRCENFT
TCWRDGKLFNAIIHKYRPDLIDMNIVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSS
PDEKSVITYVSSLYDAFPKVPEGGEGINANEVEVKWIEYQNMVNYLIQWIRHHVTIMSDR
TFPNNPIELKALYNQYLQFKETEIPPKEIEKTKIKRLYKLLEIWIEFGRIKLLQGYHPND
IEKEWGKLIIAMLEREKTLRPEVERLEVLQQIANRIQRDSIVCEDKLLLARNALQADSKR
LESGLQFQNEAEIAGYILESETLLRQHVIDAQILIDGKYYQADQLVQRVAKLRDEIMALR
SECSSVYSKGRSLTTEQTKLVISGITQSLNSGYAQTLNPCLNSGLTQSLTPSLTPSSMTS
GLSSGLTSRLTPSITPSYTPGFPSGLISNFGTGVDTNSLQTLKLMQIRKPLLKSSLLGQN
LTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHFENHKNVHKAIEEFESSLKE
AKISEIQMTAPLKLTYAEKLHRLENQYAKLLNTSRNQEQHLDTLHNFVSRATSELIWLNE
KEEEEVAYDWSERNSNISRKKEYHAELMRELDQKEEVIKSVQEIAEQLLLENHPARLTIE
AYRAAMQTQWSWILQLCHCVEQHIKENSTYFEFFNDAKEATDYLKNLKDAIHRKYSCDRS
SSIHKLEDLVQESMEEKEELLQYKSTIASLVGRAKTIIQLRPRNPDNPLKTSIPIKAICD
YRQIEITIYKDDECVLASNSHRAKWKVISPTGNEAMVPSVCFTIPPPNKEAIDTANRIEQ
QFQNVLALWHESHINMKSVVSWHYLVNEIDTIRASNVASIKTMLPGEHQQVLSNLESRFQ
DFLEDSQESQIFSGSDMTQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRL
RLENCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELDRLKDDLATITDKCEEFFSQA
AASPSIPTLRSELNIIIQNMNQVYSMSSIYIDKLKTVNLVLKNTQGAEALVKLYETKLCE
EEAVTADKNNIENLMSTLKQWRSEVDEKREVFHALEDELQKAKAISDQMFITYKERDLDF
DWHKEKADQLVERWQSVHTQIDNRLRDLEAIGKSLKYYRDTYHPLDDWIQKVEDTQRKIQ
EKQPENSKTLATQLNQQKMLVSEIEMKQNKMDECQKYSEQYATAVKDYELQTMTYRAMVD
SQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEE
EKKEHVEKAKELQKWVSNISKTLKESEKAGKSSFSKQQISSEEIATRKEQLSEALQTLQL
FLAKHGDKLTDEEKNEMEKQIKSLQEGYNLFSESLKQLQESHILRDEKVEEKLDKVIAGI
IDQTTGEVLSVFHSILKGFVDYETGIRLLEMQLILSGLISPELRKCFDLQEAKNHGLIDG
QILFQLEELSKAKEIISSASYTTIPVLDAFDKGMISESVAIRILEIQLSTGFLIIPSTGE
CLTLQKAFQRNLISSSLFSKLLERQNICKDLIDPNTSEKISLVDMVQRSILHEKTGMRLL
PIRPPEGGRITLKCGRKINILRAAHEGLIDRETMFRLIGAQLLSGGLIDSDSGQRMTIEE
AIQEGAIDLSTANCILTHQVQTGGIISSNPPTRLTVDEAVQCNLISSSSALLILEAQRGF
VGLIWPHSGEIFPASSSLQQELITNELAYKILNGRQKIAALYIPETSQVIGLDAAAQLGV
IDHNTASILKNVILPDKMPDVGDLDTSSKTARRWLSSCEFQPSTIFHEYTQQEDISDGGE
SVETQTLEQKQNLFLSYLMINSYMDANTGGRLLLYDGDLDEAISMLLENGNQEFGAMSAK
KELIGTNSRQFGDILFNSVANKKDDYSPSSFEGTCLKEPENEITLQNRKSLVDEGFNDKE
NYFMSNEFNQSECWPPNYKTKNLSDVHIPSDRVGFVQPGKRDNGMPNCDYENVLKSCKDE
NQIGTSAHVIKNTYPGNTQIDFPSDAIKHFIGIPINRSICALNEIENQDNRIKDPNIPEN
SSSENQLLHSDRVGVHQGKSVLNQDSYIQKSLISSLPFSDQSILLDPETAEGFQGLNNNN
ISISLPKGSSELRSLNVGCNAFQLQCEGNYFDKSEYSRNQSDVGKMQVVISHSESKRNRD
GSELEEYSGNSSLSSDIESIDTPDICGIQQGEEVDSATDTQASQLEDSESDTESDSDSYS
TPLLDDDHDSLLLEDDDYDCLEPEDFDILQHEADCTPHCGCVYAGFSEGNKSHVDTPGLK
HIKEEIESFQKFHRVSKENDFHSGERLNSDSIDTEVTNGRLLDTISEEESKNNSENDTPG
SVTSKCLEREENFCASLEAGETAGWVGRRGQAEFGQIAEFDVDQNIECMQNEDSYRNRKS
LFAFNDQIKCDRVEMPTSLDKDGNIMDVQMLATSHEKKGSDEIVGNNMMKIKCTKETQNF
SHLEILQNVNVLQPEPTCETNLVTKEYRCEIVGQSRGSQLIERDPKELEENKLTLQSLIN
DKESENSVGADCLLCNNDTHSISQIDNSDLGDKVTKIMQPGSESLFVVKDGNYHTESLTH
TMEHAFPENVCPDGNVIEKSSQTSYPWIMADSINQDHQGKETNDEIQGRDGKRKMLLKED
TSVPSEVKLLDRNVVDYDKDLNYFPREGTHPFPGITTIKGCSQTEEVKEASTDIANKLKD
LQALTVNKNPLHLENLGEIFDISALKMVNEIDVIYDGNSNKETEVHSDRFPSELEEEVDL
FSYLKKCAKNITAKENLNPNKNSYCHIPILTSDPLTDKQLQPGVSGTREKKIVITQEDVH
MNEIALSLNTLQQDFEKGSLIIQITSEKNATLLDLPLRTQENVGKNADMQTEPETFAAKN
EIRNKASDVSGTEISSLEINNKKEVTGQQLLKEQKLPPESHAMETQTSEFSYLLVDDLKD
ILKSRLKEGHIFCGEEGEFSSYSERKVLMQNLLKMVGLTQLVKKKSSNKFSDSKTSDYTT
VSQMTDSLEVKPEIYDNPSPLWPANLGPEVFLNILKQNQGDSKISGAFEMRKEIALNEND
SERNEIVSKVLPLQLESIFHILLADEHSPKVELVGDSNRNLPASFQTEGEQNEDSCKIKE
GSFNSEKMQEIELIASTPRESLGHNMGCQSEQLIETLQKVCSNQLEYTVDSEEVASANSP
LGKLPSVLQLCLQHTEKMHGYLTMLQDMKLPLDNQQPFDNNLETLKNQLKELESFQLGLA
PFSALIRKDMKLAEEFLHSHTSNIPKEYLEDLIISHKKLQTTLFSLHDLSSERTKQITLA
IDSEMSKLTASHEEFLHKLQKFSDWITERRKSINDLMTDTSDGENVKEQLELLKAKIVLK
ELGHNKIQLETIAFDVQFFISEYAQDLSPNQNKQLLRLLNATQKCFHDVQESITAQMEIL
ETHLHIEQDLSDQKIVAERQREYKDTLQGICDLLTQTDNRLIGHQEAIVIGDSKEELKLY
QAKQEELQKEMQKSVHALSEKVKNTEKFLMENGEKLSQEDKALIEQKLREANIKCEQLNQ
RVEQSRKELDKAVTTAIKQETEKVEAVAQLEESKHKIEDLLDWLSNVDKEGERAGKKSNQ
EIEQNGTHFQEGDLNSMIGEEDQVNGNLMEIDVDGQVKTKEENLNQQYQKVKAQHEKIVS
QHQAVIIATQSAQALLEKQGHYLSLEEKEKLQRNMKELKTQYETALAESEKKVKLTNSLQ
EELEKFDADYNEFDSWLQQSEQELENLEAGADDFSGIMIKLKRQKSFSEDVISHKGDLRY
ITISGHRVLEAAKSCSKRDGGKDDKENLGTSATYKEVQGKLDLASERFKSVYTKCSMLGN
NLKDLVDKYQHYEDASAGLLSGLQSCETAANKHLLEPIAMDPKNLQRQLEETKVLQGQVS
SHQAAVEKLKKTAEVLLDTRGALLPDKNDIQKTLDDIVGRYDNLSKSINERNEKLQITLT
RSLSVQDGLDEMLDWMGSVENSLKEHSQVALNSAAIQDIISQNMMLEQDIAGRQSSIKAM
NEKVKKFVDTTDPSTASSLQAKMKDLSVRFSEASKKHKEKLHNLEKLKTKVESFERLSEK
LQSFLETKPQALVEMDCPGKDVTELSLYFQESSNQVLECKKDLETLQNFLKEFSVHGFPA
DKALLLEKTNALSKKFKELEETIMEKKQAVSSCQEQMESFQLLVKSLKTWMEETTEKIPI
MQTSMGADDLKKSLEETKKLQGEWSSKAPEIQKVNNKGTSLCNLISAMTSPTKAIAVIKS
GETVLNGEGTISDTQEFLTNKELTSNKKKMADINQNYENLGVALKDKIFELDAKIKVLQK
AQEESSSMLQWLDKMDKKATGWDTTPTDSEGVKTQVEQNKTIETELKQNVNKVQELKDKL
TDLMEQNPGTPEAPKWKQTLAEIESKWEQLNQVTADRQQKLEESSNNLTQFQMVEAQLKQ
WLVEKELMVSVLGPLSIDPNMLNTQKQQVQILLKEFDTRKPQYEQLTTTAHSILRKPDED
HPLHGSVKEQLTIVAQKWDSLTGQLSDRCSRIDQALVKSTQFQNLLRNLSEKLSDLDNKL
SNSLAVSTHPDAMEQQLETAQKMKQEVEQEMKNIKVAQTLCEELSALVGEEYLKAELSRQ
LEGILKTFKNIEQKSGNHVQQLQSACASSYQFQQMSKDFQAWLVTKKEEQKQFRPISAKL
DVLQELIKDQNEFRKVLTDHYDSYEKTIAEGENLLLKTQETEKAGVQLQLNKIKTNWEDL
NKQATERQEKLNDCLEKALKYREHVVNLQPWIEKCQKSLMDIKVCLDPEETEKLISKVKV
LQKEKDQRFGMMELLNNAANNLLNASETDKEIVTEENKLLVEKVDMVAEELHSKKHSLET
MAQQLKEFQENTREAHRQLICAKEQLEIHNSLGPQACSNKHLTVMQAQQKSLQALKGQID
STKKFAQDMILEASDSRGTSDLLLEAEYLEKEHSIVSQQVEEKCAFLETKLQGIGHFQNT
IREMFSHFAEFDDELDSMASVGRDRDTLQRQKSDIKNFLKKLEDLINDNENANKTCKIML
ATEETSPDLVGSKRDLEALSKQCNKLLDRAKAREEEVEGTICRLEEFYNKLEDFCNLLQK
AKEHEESQGAVGMETETINQQLIVFKAFQKEEIESLQAKQQEVNWLGQGLIQSAAKSANT
ENLEHDLDDVNARWKTLNKKVAERAAQLQEALLHCGRFQDALESLLSWLADTEDLVANQK
SPSAEFKVVKAQIQEQKLLQRLLDDRKPTVEAIKTEGEKIAAAAEPADKVKILKQLSLLD
NRWDVLLNKAETRNRQLEGISVVAQQFHETLEPLTEWLTSTEKKLTNWEPIGTQASKLQE
QIAQHKAIEEDIISHSKTIQQAVSIGQSLKILSSREDKDMLQEKLDSFQVSYVEIQEKSH
SRSKLLQQAFCNAQIFGEDEVELITWLNEVHDKLSKLSVQDYNTDGLSKQQSELLALQED
ILLRKQNVDQALQNGLELLKQTTGDEVLIIQDKLEGIKARYKDINELSSDVAKTLEKALQ
LSGQLQSTHENLCAWLDKVELELLSYETQDLKGEALGRAQERQKELKKESKSNKHLVDVL
NEVSSALLELVPWRAREGLDKMVTEDSERYKLVNDTLAQKVEEIDAAILRSQKFDQAADA
ELSWIAEIEKKLRSLGNIRLEQDQTSAQLQVQKAFTMDILRHKDIIDELVKSGDKIMSTC
HEEEKQSMKEKLDKILKNYDDICQINSERYLQLEQAQSLVNQFWETYEELWPWLTEIQRV
ITQLPAPALEYETLKQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFLIQEKY
LAADALYSQIKEDVKRRAVALDEAISQSTQFHDKIDQTLESLKRIVERLKQPPPISAEVE
KIKEQISENKNVSVDMEKLQPVYETLKKRGEDMIARSEGTDKDISAKAVQDKLDQMVTIW
ESIHTLAEEREAKLLDVMELAEKFWCDHMSLVVTTKDTQDFIRELEAPGIDPSVVKQQQE
AAEVIREEIDGLQEELDMVVNLGSELIAACGEPDKPIVNKSIDELNSSWDSLNKAWKDRV
DRLDDAMQTAVQYQDGLQAIFDWVDIAGGKLASMSPIGTDLETVKQQIDELKQFKSEAYQ
QQIEMERLNHQADLLLKKVTEESDKHTVQDPLSELKLIWDSLDERIINRQHKLEGALLAL
GQFQHALDELVTWLTHTEDLLNEQKPVSGDPKAIEIELAKHHVLQNDVLAHQSTVEAVKK
AGNDLIESSAGEEASNLQTKLEIVNQRWQNVFEKTQQRKKQLDSALHLAQGFHGEVEDLY
QWLTDTERHLLASKPVGGLPETAREQLNTHLELCDAFEVKEETYKCLMKKGQQMLTRCPE
SADTNVDQDINNLKEKWESVEAKLGERKAKLEDALNLALEFHNSLQDFINWLTQAEQTLN
VASRPSLILETVLFQIDEHKVFANEVNSHRDQVIELDKNGTHLKYFSQKQDVVIIKNLLI
SVQSRWEKVVQRLVERGRALDEARKRAKQFHEAWSKLMEWLEESEKALDSELEIANDPDK
IKTQLTQHKEFQKALGAKHSVYDTTNRTGRSLKEKASLTDDNLKLDDMLSELRDKWDTIC
GKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDMDLVMNLIDNHKV
FQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETICALSVSKQTRLEE
ALHQAEEFHSVVHVLLEWLAEAEQTLRFHGLLPDDEEALRNLIDQHKEFMRKLEEKRAEL
NKATGMGETVLAICHPDSITTIKHWITIIRARFEEVLAWAKQHQQRLTSALAGLIAKQEL
LEALLAWLQWAETTLNEKDKEVLPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKTKTLQRR
AADPSPLTSHILIYGTHSARGKHSPTSSLYPSGSQTQIETKNPRVNLLLKEFANFDFDIW
RKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDR
DGDGYIDYYEFVAALHPNKDAYKPLTDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRF
FLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSS
ITTTQPTIAKGRTNMELREKFILADGASQTTMAAFRPKGRRSRPSSRGASPNRSTSVSNP
AGQVASPPAPIISTPKGTPIQGSKLRLPGYLSGKGFHSGEEGGLITTAAARVRTQFAETK
KNPSRPGSRAGSKAGSRSSSRRGSDASDFDISEIQSVCSETETVPQANKPTPRAGSRPSS
AKPSRIPTPQRRSPASKLDKSTKR
Download sequence
Identical sequences F7AE13
ENSMODP00000023407 ENSMODP00000023407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]