SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024647 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024647
Domain Number 1 Region: 60-176
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000663
Family Spermadhesin, CUB domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024647   Gene: ENSMODG00000019745   Transcript: ENSMODT00000025083
Sequence length 325
Comment pep:known_by_projection chromosome:BROADO5:3:39929793:39942736:-1 gene:ENSMODG00000019745 transcript:ENSMODT00000025083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRMSPAFKLQCHFILIFLGALRGETRYLELREVAEADPLLLFNTDLKRELSEEQLYHR
SLRCIDMLSIEGQFTFTAEQPQLQCAAFFIGEPEEVISIQYDLVSVDCQGGDFLKVFDGW
ILKGEKFPSSQDHPLPMSDRYIDFCESENIRTFSSSQNVAMIFFRIHEPGNGFTITVKKN
PNLFPCNVISQTPNGRFTMVIPHQHRNCSFSIIYPVVIKISDLILGHLNGLQLKKPSVGC
GGIGDFVELLGGTGLDPSKMMPFADLCYPFHGPAQLTIGCDNTVVRMVSSGKHVNRVTFE
YHQLEPYDLGSPSGNSIKEYCFPSI
Download sequence
Identical sequences F6WNR7
ENSMODP00000024647 XP_001381651.2.35504 ENSMODP00000024647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]