SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024799 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000024799
Domain Number - Region: 149-249
Classification Level Classification E-value
Superfamily SET domain 0.000772
Family Viral histone H3 Lysine 27 Methyltransferase 0.074
Further Details:      
 
Domain Number - Region: 670-1142
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0296
Family Hermes transposase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024799   Gene: ENSMODG00000019874   Transcript: ENSMODT00000025239
Sequence length 1202
Comment pep:known_by_projection chromosome:BROADO5:5:282045146:282089395:1 gene:ENSMODG00000019874 transcript:ENSMODT00000025239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAHVPAKNVAPRRPACLPGRMTENLKACLAHTQASMGEMVTVKTEVCSPRRDQEYGQPC
SGRPDPPSMEVEPKKPKGKRELIMTKSFQQVDFWFCESCQEYFVDECPNHGPPVFVSDTP
VPMGIPDRAALTIPPGMEVVKEASGQSDVRCMNEVIPKGHIFGPYEGQISTQDKSAGFFS
WLIVDKNNHYKSIDGTDETKANWMRYVVISREEREQNLMAFQHSEKIYFRVCRDIRPGER
LRVWYSEDYMKRLHSMSQETIQRNLTRGDKKLQREKPEKALDHQEDLRGPLQLTVLRHGK
SAYKRGFDEVDAHPPPKKKKIDLIFKDVLEASLETSKIEEHPLAPGTPLVLRKAPKFHTE
DVYDQCGMAISHGPQDLSRNQGEKEWKAPQGASYGPSKDTSLLEDEEEEPSSFKADSPAE
ASLASDLHELPTTSFCPNCIRLKKKIRELQAELDMLKSGKLPEPPLLPPQVPELPEFSDP
TASESVVSVPTMLEDDDQEVDSADESVSNEMITATDEPSKMSSATGRRIRRFKQEWLKKF
WFLRYSPTLNEMWCHVCRQYTVQSSRTSAFIIGSKQFKIHTIKLHSQSNLHKKCLQLYKL
RMHPEKTEEMCRNMTLLFNTAYHLALEGRPYFDFRPLAELLRKCELKVVDQYMNEGDCQI
LIHHIARALREDLVERIRQSPFLSIILDGQSDDILADTVAVYVQYTSSDGPPATEFLSLQ
ELGFSTTDSYLQALDRAFSSLGIRLQDEKPTIGLGVDGANITASLRASMFMTIRKTLPWL
LCLPFMVHRPHLEILDAISGKELPCLEELENNLKQLLSFYRYSPRLMCELRLTASTLCEE
TEFLGDIRAVRWIIGEQNVLNALIKDYLEVVAHLKDVSGQTQRADASAIALALLQFLMDY
QSIKLIYFLLDVIAVLSRLAYIFQGEYLLVSQVDDKIEEAIQEISRLADSPGEYLQEFEE
NFRESFNGVAVKNLRVAEAKFQSIREKICQKTQVILAQRFDSRSRTFVKACQVFDLAAWP
RSTEELMSYGKEDMIQIFDHLETIPSFSREICREGMDPRGSLLMEWRELKADYYTKNGFK
DLISHICKYKQRFPLLNKIIQILKVLPTSTACCEKGRVALQRVRKNNRSRLTLEQLSDLL
TIAVNGPPIANFDAKRALDSWFEEKSGNSYTLSAEVLSRMSALDQKPMLPTMDHGSEFYS
DL
Download sequence
Identical sequences F6RQQ0
ENSMODP00000024799 ENSMODP00000024799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]