SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025586 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025586
Domain Number 1 Region: 6-164
Classification Level Classification E-value
Superfamily PR-1-like 7.06e-53
Family PR-1-like 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025586   Gene: ENSMODG00000020450   Transcript: ENSMODT00000026038
Sequence length 241
Comment pep:known_by_projection chromosome:BROADO5:8:44314501:44329217:1 gene:ENSMODG00000020450 transcript:ENSMODT00000026038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTLPKITNEDFIKECVDIHNKLRSSVSPKASNMLKMSWDPDLAKTARAWAKRCEFKHNIY
LDTAKMAHPTFNPVGENMWTGSLGQFTPTVAIQMWYDEVKNYDYQTQKCTGVCGHYTQVV
WANSYKIGCAVQFCPKVKGFGALSNGAHFLCDYGPAGNYPTRPYKKGNACSDCRGEKCVK
KLCENPSRDEVKGTNFHPVWEIFERNRKLSLTLTLGPLFIILFAIVVSLIKHYYPRQVTS
E
Download sequence
Identical sequences F7A3E5
ENSMODP00000025586 ENSMODP00000025586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]