SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025673 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025673
Domain Number 1 Region: 1124-1299
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.03e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.00084
Further Details:      
 
Domain Number 2 Region: 686-801
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.0017
Further Details:      
 
Domain Number 3 Region: 453-574
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-25
Family Pleckstrin-homology domain (PH domain) 0.0000182
Further Details:      
 
Domain Number 4 Region: 920-1039
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-20
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 5 Region: 1435-1568
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-16
Family Pleckstrin-homology domain (PH domain) 0.083
Further Details:      
 
Domain Number 6 Region: 5-72
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.98e-16
Family SAM (sterile alpha motif) domain 0.00021
Further Details:      
 
Domain Number 7 Region: 588-699
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000629
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 8 Region: 1017-1116
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000959
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025673
Domain Number - Region: 1329-1416
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0682
Family Ras-binding domain, RBD 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025673   Gene: ENSMODG00000020518   Transcript: ENSMODT00000026130
Sequence length 1697
Comment pep:known_by_projection chromosome:BROADO5:5:188634079:188860331:1 gene:ENSMODG00000020518 transcript:ENSMODT00000026130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEVNPELRELLTNINLEQYLGCFQQSGYHTLKDCAQINDGILQKIGVLPTGHRRRI
LKQLEMILSRLPEPVVYANIQKRKKEPELFEDAQPSSAGPESWGQISSVCGNHSAGPEPL
EASATVGGRHDICNENRPSTESVGTSSPSQHSDSPLVDTASLQNLDACQDLALDGGKAEN
ATSVTKKNVDYAEGNEPIGKVGWNVDSPGVSHNEERGPLSSLDYSSSKTGSENKPGILSA
KPPSSPFFEFKGEMIVNDLYVSSTQSPVPMRSRSKLVSRPSRSFMLRHRPVPEIPVTSKG
AISGSYARERRNGGNSNGKTLQQSLEEQSSLIFPYGDTFIFKSKNTENSKKSLKNEFWTV
EEKIKKEAGPEMSSFFEQSSIYDNRMKTCEDKVEDIWIPREDKTAFPLDSASESEYSTVE
ECFNSLRRRSSKTSKSRAQKGSLDLAANRHSYPLSSISGFVDQPTLTSNSISPYACYYGS
SAKKVKSGWLDKLSPQGKRMFQKRWVKFDGFCISYYNNEKEVYSKGIIPLSAVSTIRGQG
DSKFEVVTSQRTFVFRVEKEEERNDWITILLNALKSQPLAPQSRAVLPEKCGYLELRGYK
AKIFTALNGSNVWLCKNEQDFKSGLGITVIPMNLANVKHVDRTVKQSFEIITPYRSFSFT
AESEKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNKNCADCKAPDPDWASINLCVVIC
KKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDKELQIN
ASVEERKLFITQKYKEGRFRKTLLAFLTKEELNKALCAAVVKPDVLETMTLLFSGADVMC
ATGDPINSTPYLLAKKAGQSLQMEFLYHNKFSDFPKHDIHFESGLPQESSHSTFLCDFLY
QVPSVAAKPSTEKKMIEETNKKWCVLEGGFLSYYENDKATTPNGTINMNEVICLAIHKED
FYINTGPIFSFEIYLVSERAFLFGAETSQTQRKWTQAIAKHFVPFVAENLAEAEYDLIGQ
LYYKDCHTLDQWRKGWFAMDKSRLHFCLQMENAEEELMYLRRLQELTISTVVQNGEKIDV
LLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVT
QYGLGSKHIYQKDGDSFHVSELLESFRKDARSFKLRAGKHQLEDVTGVLKSFLSDTDDAL
LTKELYPYWISTLDTQDDKERVKKYSTFIRTLPGVNRATLAAIIEHLYRVQKCSEINQMN
SHSLAMVFSSYLFQTKGQTSEEVNVIEDLINYYVEVFEIKEDQVRQMDIENSFITKWKDT
QVSQAGDLLIEVFVEKKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVI
ENEELERPLHYTENVLEQVLQWSTLAEPGSAYLVVKRFLTMNVIKHYNEKSAMESVKEGV
MKFKEEPSKILSGNKFQDRYFVLREGYLFLYKDIKSSKADKMLPLNSLKFYLGVKKKMKT
PTSWGLTAYSEKHHWYMCCDGPQTQMEWFSSIFLAQHDNDIWPPAGKERKRSITKNPKVG
GLPLIPIQHEKNTNQARRNIENAKAGVERLKPPEKLDKEQIEGSLRERASMVAHCLERKE
EKHRNRTKKHRSLNCLEDTGADILHSQQKAQKDFKILKKTEDKSSKSSPETDNKLPSKVI
EELNVVLQRTRTLPKDP
Download sequence
Identical sequences F7ENT4
ENSMODP00000025673 ENSMODP00000025673 XP_001374806.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]