SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025684 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025684
Domain Number 1 Region: 875-1055
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.49e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0033
Further Details:      
 
Domain Number 2 Region: 1030-1151
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0051
Further Details:      
 
Domain Number 3 Region: 159-192,249-397
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-29
Family Phosphotyrosine-binding domain (PTB) 0.0053
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-17
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025684   Gene: ENSMODG00000020529   Transcript: ENSMODT00000026141
Sequence length 1228
Comment pep:known_by_projection chromosome:BROADO5:5:186493890:186805852:-1 gene:ENSMODG00000020529 transcript:ENSMODT00000026141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTAKKHAFPSEISVDFSLQLVGSLPVHYLTTMPMLPWVVAEVRRLSTQSSKKEHV
VNQIRLCVSPACLKCEPDPGKSHQWDPLICSSIFEYKPQQVHKLIHNSHDPSYFACLIKE
DTASQQSICYVFKADDQTKVPEIISSIRQAGKIARQEEFHSQSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSCSRKAELDMLAQNSEAISTVGGFSLTDKFRSVFQPG
GSAEQDRKPMRKSFSQPGLRSLAFKKEFQDAGYRSSSFFGGSFEENDIQSHLISGHNIVQ
PTDIEENRTMLFTIGQSEVYLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSE
NGGFHFVCYVFQCTNEALVDEIMMTLKQAFTVAAVQQQTSRVPVQQCEGCPMHYLHKLCE
RIEGMSSSKTKLELQKHLTTLNNQEQATIFEEVQKIRPRNEQKENELIISFLRCLYEEKQ
KDHVHIGESKQTSQISAETIRNELPTNAPRFRLDMLKSKAKRSLTESLESILSRGSKGKG
LPEQSGSVDLDSSVSSTFSNTSKELSMGEKELPALPEGSCPPPGSLDDLSSTSGSPLPEE
AAPPSPRQEFRRRANTLSHYPVEGQKPPEPPEASPGLPQRKLMSLNPPVDESKSRSGQSS
TPALPPHRLNPSASSPNFFKYLKHNSSGEQGGNAVSKSISYRSALRKKLHSSSSVPNFLK
FLAPVDENNTSDFRSTKRDFESKTHHHDSNNESPLKTRRHSWRQQIFLRVATPQKGCDSP
SRFEDYSDLGDLPPRSPLEPVCEDGPFGPVIEEKKRTSRELRELWKKAILQQILLLRMEK
ENQKLQASENDLLNKRLKLDYEEITPCLKDVTSVWEKMLSTPGRSKIKFDMEKMHSAVGQ
GVPRHHRGEIWKFLAEQYHLKHPFPNKQQPKDTPYKELLKQLTSHQHAILIDLGRTFPTH
PYFSAQLGAGQLSLYNILKAYSLLDPEVGYCQGLSFVAGVLLLHMSEEDAFKMLKFLMFD
MGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYSHLEEHEIGPSLYAAPWFLTMFASQFP
LGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQME
KTINQVFEMDISKQLQAYEVEYHVLQDELIDSSPLSDNQRMDKLEKTNSSLRKQNLDLLE
ELQRKTPRFKYYCYFMADLELEPYSLDS
Download sequence
Identical sequences F7ENI0
ENSMODP00000025684 ENSMODP00000025684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]