SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026100 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026100
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Hormone receptor domain 5.89e-23
Family Hormone receptor domain 0.00055
Further Details:      
 
Domain Number 2 Region: 99-291
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000348
Family Rhodopsin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026100   Gene: ENSMODG00000020873   Transcript: ENSMODT00000026565
Sequence length 407
Comment pep:known_by_projection chromosome:BROADO5:Un:13719846:13733341:1 gene:ENSMODG00000020873 transcript:ENSMODT00000026565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLVHPECNLLQELKKNELACLPTAEELRNGTAGCQREWDGLLCWPAMGAGASVALPCPD
FFSLFSPKPGTVRRDCTGLGWSDPSPTYMEACPVELESLTEEKAYFSTVKAVYTVGYSIS
LASLLIASIILMTLRRLRCPRNYIHVQLFCTFIFKAVAVFLKDATVLQGEDEVDHCTFST
TSCKLSVAFSYYATMTNFTWLLVEALYLTCLLATSFPNGTRYFWWLVLGGWGFPTLFILI
WIGFKLAFEDKVCWDMNEDSPYWWIVKGPIVLSVGVTFGLFLNIIRILLKKLDSGQNNFH
SHAHYRWGVRGPWLSPLPGKARSRTGLSPLGFQATSWQGRPRGGQGGWRERNEPEPPLLR
PGGLDCLLMEGLESSAGVGLRLGLLLGFGSFQGFLVAVLYCFLNHEV
Download sequence
Identical sequences H9H7P0
ENSMODP00000026100 ENSMODP00000026100 13616.ENSMODP00000026100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]