SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026810 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026810
Domain Number 1 Region: 298-440
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-39
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 194-299
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-37
Family Second domain of FERM 0.00000288
Further Details:      
 
Domain Number 3 Region: 113-193
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-27
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026810   Gene: ENSMODG00000021459   Transcript: ENSMODT00000027291
Sequence length 1100
Comment pep:known_by_projection chromosome:BROADO5:3:271426818:271538115:-1 gene:ENSMODG00000021459 transcript:ENSMODT00000027291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKQDQEPEHEEASGQQGQAGAQQQPAEQPLREEQQQALEQFSAAAAHSTP
VKKEVTDKEEELAATASRQLEYQQFEDDKLSQKSSCSKLSRSPLKIVKKPKNMQCKVILL
DGTEYLCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDTENQKNWLDPAKEIKKQIRS
GAWQFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSEL
GDYDPDECGSDYVSEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYG
VDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFE
QFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTR
RASALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYTTTKGISQTNLITTVTPEKKAEEE
HDEEEDKRKKTEEVTPVSAIRHEAKSPWLGNNSFSFSPSSHNGPTASPTTLRRRCKENVQ
KALGCEPAKDTGQNRGEPDLDSSGKGKAYSGDQDLAFSYKQQTCKGATLFSFSLQLPESF
PSLLDDDGYLSFPNLSETNFLPANLQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALTL
SFPLAMCLCYLEPKAASLSASLDNDPSDSSEEETDSEQTDTAADGETTATESDQEEDADL
KAQELDKNQEELVKHQTNISELKRTFLETSTETAVTNEWEKRLSTSPVRLAMRQEDAPMI
EPLVPEETKSTGEKILDGSDIFTLIDSARKPTEFIGGVTTSSQNWVQRTETKTEPSEIQK
ESTEQHQQLSSEKVVQQTVVVEERRVMNVHASGDGSNLAGTHLDAAAQAVSAVASNVTGK
AGSALIEGAKEEKREEEEEAADKAVIKQEEIATASHEQEEEEQTARSLISESLESKPQFE
SSSVKTETISFGSVSPGGVKLEIATKEVPVVHTETKTITYESSQVDSSADSEPGVLMSAQ
TITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDM
SVTKVVVHKETEITPEDGED
Download sequence
Identical sequences F7GDV6
ENSMODP00000026810 13616.ENSMODP00000026810 ENSMODP00000026810 XP_001369462.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]