SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027412 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027412
Domain Number 1 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.88e-27
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 498-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.94e-27
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 414-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.01e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 131-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 361-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 247-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 7 Region: 187-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.97e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 539-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-21
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 10 Region: 86-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000154
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 11 Region: 460-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000169
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027412   Gene: ENSMODG00000022825   Transcript: ENSMODT00000028953
Sequence length 592
Comment pep:novel chromosome:BROADO5:Un:15063086:15129643:1 gene:ENSMODG00000022825 transcript:ENSMODT00000028953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSIQESLTFKDVAVEFTWEEWRHLDPAQRALHTNVMLENYENLVSIGKQNQPLLEMKEM
TAELSLSGEETQRQRCIGDGACDSTWRENLDVHQKIHTGGKPFECNLARLTVHQRIHTGE
KPFECNQCGKTFARKSHLIAHQRIHTGQKPFDCNQCGKAFIQKVTPTVHQRIHTGEKPFE
CNQCGKAFRSRNNMVKHQRFCNGEKPFKCNQCGKTFIQRTKLTEHQRIHTGEKPFECNQC
GKAFRSRNSLLTIHQRMHTGEKPFECNQCGKGFIQRTKLTVHQRIQTGEKSYECNQCGKA
FSQKSGLTVHQRIHTGEKPFECNQCGKSFTHKSGLTVHQRIHTGEKPFECNQCGKAFIQK
RAYLTKHQRIHNGEKPFKCNQCGKAFIRRSSFTEHQRIHTGEKPFECNQCGKAFRGRDGL
IIHQRIHTGEKPYKCNQCGKAFTNRSALTVHKRMHTGEKPYECNHCGKAFRCRKSLVKHQ
RIHTGEKPFECNLCGKGFSQKSHLTVHQRIHTGEKPYECNQCGKAFTYESRLAVHQRIHT
GEKPYECNLCGKAFSQKSGLTVHQSINTGEKPYECNQCGKAFTYESHLNVHQ
Download sequence
Identical sequences H9H9D2
ENSMODP00000027412 ENSMODP00000027412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]