SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028259 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028259
Domain Number 1 Region: 705-887
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.05e-40
Family DBL homology domain (DH-domain) 0.0000348
Further Details:      
 
Domain Number 2 Region: 897-1012
Classification Level Classification E-value
Superfamily PH domain-like 1.27e-34
Family Pleckstrin-homology domain (PH domain) 0.00042
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028259
Domain Number - Region: 513-589
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000468
Family Spectrin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028259   Gene: ENSMODG00000005997   Transcript: ENSMODT00000029841
Sequence length 1169
Comment pep:known_by_projection chromosome:BROADO5:1:684539879:684548527:1 gene:ENSMODG00000005997 transcript:ENSMODT00000029841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSDGEEDSLDPVVAQAHATDWRYAVCSYEEGPEPPEAEAEASTPPGPPPGAVDPQLSART
PLPDGQSGEEGTAGAQPEEAEPCGSESPPSPRPATGLKSPGGNWGREGTEGLMARGRASR
SAPQAEPQQEPSKSPGLGLTRLQRLSSGDPEQCPALPVPVMPTTAQDLCPQLLASGLAVL
PGTRDSEGRAVLLVFAHHPAWHGPHCGTQELAGLFLYLRSIPSPEVQALGLTVLVDARHC
PPSPHLFLGLGEMQKAVPGSVHQVLLLGKMSGAPPPGLKLELLSSRQALLAFIPNSQLPL
TLEGCLPYSHSAWLDFRKRLEALQRSCLEACALLRAAIESVEAAPEPEGPGGAGQLLQDP
QELMKRVLNDPQLTQLQREGGTALAQLQWEDPGVVQSPDYRLAVAEAGKLYAQVDGLLHQ
LVTLCNQRMRALELGKTVEAQAGTLAEIQAWLQKVGWPGLKGPEEPSLDMLLEARDAFWE
LDRVGQEHVRQAEGILAGWEAEELGRLGARGARLLSLQTLLSEFSGALAHRRRQLMDAQQ
LSHLLDQALAWAQDRQKALARLAEEKRASPEAVLHYLQQHRALHPDLAPSHFQEMRALAA
GLGSNLATQQCHLVWIQCQDAQLALDRKLEAALRARQVLPALAKGWECPRGGGSSSSSSS
DQASLAPLSLVPGEGEAGAGRDPRVAGRGGSPGRTGPELCPPGRLRLVLGEMVATEREYV
RALNYVVESYFPELERADVPQVLRGQRAQLFGNLEKLWDFHRHFFLRELESCSQHPLRVA
HAFLRHREQFGLYALYSKNKPRSDMLLASHGNAFFKDKQRQLGDHLDLASYLLKPIQRMS
KYALLLQELSQTCEEGPGPSWAREPDLAALRAARDLVRFQLRHGNDLLAMDAIRGCDVNL
KEQGQLVRQDEFTVWSGRKKCRRQVFLFEELVLFSKARHRPQGTASFIYKQSFKTSDIGL
TENCGDSGLRFEIWFRRRKAGDTFVLQATTQENKRAWTADIASLLWRQAARNKELRMAEM
VSMGVGNKPFLDIAPSEAAISDRAINYIMKGRGARTRASIAVSLFDHTNPYPGPPASLPT
GPSSCSLLGPLNLHLCGDPTRLGLHWPLHRTSYPEEDLDPETETGSQPSLTPESSEASSQ
CPSASSSSSESDCVPGLPLASSCEDQSMV
Download sequence
Identical sequences F7BP74
ENSMODP00000028259 ENSMODP00000028259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]