SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028514 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028514
Domain Number 1 Region: 558-646
Classification Level Classification E-value
Superfamily PH domain-like 6.27e-21
Family Third domain of FERM 0.0044
Further Details:      
 
Domain Number 2 Region: 373-465
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 270-316,501-557
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000014
Family Second domain of FERM 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028514
Domain Number - Region: 29-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00547
Family Ubiquitin-related 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028514   Gene: ENSMODG00000003919   Transcript: ENSMODT00000030097
Sequence length 669
Comment pep:known_by_projection chromosome:BROADO5:1:621122040:621177856:1 gene:ENSMODG00000003919 transcript:ENSMODT00000030097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKMFSSSDFGTTSWELIIRLDHQNEKEQKVFTLRVSGDLHIGGVMLKLVEQINIAQDWS
DYALWWEQKHCWLLKTHWTLDKYGVQADARLLFTPQHKMLRLRLPNMKTVRLKVSFSSVV
FKAVGDICKTLNIRRSEELSLLKPSDDYFKKKKKKEKNNREPLIEDILNLDNSITSSGSP
VLLSLSPMLHFVDSPLTGQNCNILAFSQPSCSPETLAEMFQPRSLIDKAKLNAGWLDSSR
SLMEQGIQEDEKLLLRFKYYTFFDLNPKYDAIRINQLYEQARWSILLEEIDCTEEEMLIF
AALQARINKLSLSAETLDFTNESEVDEVEAALSNLEVTLEGGKTDNILEDITDIPKLADY
LRLFRYYSFIFRAKKLTLKTFKLYWFVFKDTSIAYFKNKDLEQGEPVERLHLRGCEVVPD
VNVSGRKFGIKLLIPVADGMNEVYLRCDNENQYARWMAACILASKGKTMADSSYWPEVNN
ILSFLKMKNRNTSSQAPSDPECMDMKPECFVSPRCAKKHKPKQLAARILEAHQNVAQMSL
VEAKLRFIQAWQSLPEFGLTYYIVRFKGSKKDDLLGVSYNRLIRIDMATGDPITTWRFAN
MKQWNVNWEIRKVTIEFDQNVSIAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDL
FHKLTGGQE
Download sequence
Identical sequences F7EDJ0
ENSMODP00000028514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]