SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029462 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029462
Domain Number 1 Region: 409-552
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 305-410
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-36
Family Second domain of FERM 0.00000348
Further Details:      
 
Domain Number 3 Region: 226-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-25
Family First domain of FERM 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029462   Gene: ENSMODG00000017602   Transcript: ENSMODT00000031037
Sequence length 1011
Comment pep:known_by_projection chromosome:BROADO5:2:404500982:404701179:-1 gene:ENSMODG00000017602 transcript:ENSMODT00000031037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSFQKASPVIMTTEVGSESEVNKQDEQIGSDTAQEKPDEEAPESQQNPSSEPEEVKSPT
SPPAAVVSKSSPRSQKKEKDPSESRGISRFIPPWLKKQKSYTLVEVKDGVERKEPAEPLL
EEAAVEKDESAAEEGSMARGDAEEVLERKRQGVRADEKEEKHSVSSAETQPAKEDSKEIE
VAKVEGIQEEKQEGEAAKRETKEVQTTELKAEKTAQKASKKIKTVPCKVILLDGTEYSCD
LEKRATGQILFDKVCEQLNLLEKDYFGLLFQENDQKSWLDPSKEIKKQVRNLPWIFTFNV
KFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHVLLGSYTLQAELGDYDPEEHN
SDYISEFQFAPNQTKEMEEKVIELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDS
EGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFK
LPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASNLIDR
PAPYFERTSSKRVSRSLDGAPVGVVDQKDFSGPAGDVSVYGPGIASHSMFQDGDGRREFR
SPTKTPQLQFTTEGKSLEEEITSILFSKEGFSASMKATFTSTSTRPAEGSVVNYSVPSEM
LSSSPFSQLLEKRAPTAEGPCSGANDTVKSSHETLNVVEAKKQAEVGKEERVITEGVNGR
DKVPPGSDPGETRKVESLAHKDSPSLSSENSSSSSSDSEEEDVGEYRPHHRVTEGTIREE
QEENEEELEEEKEERASKVVQCVEAVPEASSVKQITVETVVQENVVSQKVSGEKSLKEGD
EQDMREETEEEQHRVNGEVSHVDIDVLPEIICCSEPPVVKTEMVTISDASQRTEISTKEV
PIVQTETKTITYESPQIDGGAGGDAGTLLTAQTITSESVSTTTTTHITKTVKGGVSETRI
EKRIVITGDADIDHDQALAQAIKEAKEQHPDMAVTRVVVHKETGITEEEEE
Download sequence
Identical sequences F6QKM6
ENSMODP00000029462 ENSMODP00000029462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]