SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030870 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030870
Domain Number 1 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.61e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.97e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.07e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 613-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 9 Region: 60-119
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.26e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 10 Region: 180-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000126
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030870   Gene: ENSMODG00000028709   Transcript: ENSMODT00000032441
Sequence length 672
Comment pep:novel chromosome:BROADO5:3:502395014:502408028:1 gene:ENSMODG00000028709 transcript:ENSMODT00000032441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAVPSRPPPASHKAGMQRPRGKRSAPSCVRREKSWEVGTPEAPAAFSVFPIARRPERP
KEAVTFKEVAVDFTGEEWCLLSPPQKELYKEVMLENAQNLLSVGLPGPPEDVISSLEQRE
APWILEQEGLRSCCPEGEIRPEMKENPTEMNSSMEEIDLHRFMSDGSNEFAFREFCDIPQ
NSSHIEHQRMHTEEKSSEINECPKTFIHRTRLGRRQRIHTKDRLYECKPGRKTYRESSSL
AVNQRVHSSEKPYKCKQCGKTFSQQSSVAVHQRIHTGERPYECKQCGKTFSYRSGHAEHQ
RIHTGEKPYECKVCGKVFRYSSAFAAHQRIHTGQMPYKCNQCGKTFRYRNVFAKHQRIHT
GEKPYECRQCGKTFTSNSQLAVHHRIHTGEKPYDCKQCGKAFIRRDQLAVHLRIHTGEKP
HECKQCEKTFNRKSSLAEHQKTHTGEKPYECKQCGKTFSHSSSLAAHQRIHTGEKPYDCK
QCGKTFSQRSHFAAHQRIHTGEKPYDCKQCGKTFSQSSTLSVHQRIHTGEKPYKCKQCGK
TFTNNSNLAVHQRTHTGEKPYECKYCEMTFSESSSLAVHQRIHTGEKPYDCKQCGKTFSQ
SSSLAAHQRIHTGEKPYECKQCGKAFSQGSALAVHQRIHTGEKPYECKQCGKTFGHSSTL
SVHQRRHTAEKP
Download sequence
Identical sequences F7D9X7
ENSMODP00000030870 ENSMODP00000030870 XP_007490259.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]