SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031275 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031275
Domain Number 1 Region: 640-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.74e-26
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-24
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 361-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 305-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 71-131
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 9 Region: 696-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 10 Region: 248-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031275   Gene: ENSMODG00000000349   Transcript: ENSMODT00000032846
Sequence length 753
Comment pep:novel chromosome:BROADO5:3:499519009:499524845:-1 gene:ENSMODG00000000349 transcript:ENSMODT00000032846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRRRRPQPQPLRSSATVERTRACVTAPERWAQPGHASRQPSLPWTARFSGQSSAERAR
MAPTPGRAPPRQERVTFGDVAVDFTLDEWVCLDSAQKALYRDVMLENYGHLVCLGLAGAK
PAVIQRLERGEAAWCPGVPGSRLPDWETRLENQELNPVLGIFMEEPSKGKIRRNSPYFLN
LREAWEYSTSLKSLQNHENKHSSQVKITQRKHSNKAKGHKYHKNGRSSGVESVFSELITP
KGNKYGKSFSNHSDLIENHRLHTDKKSYECKECGKTFLWLTELTHHQRIHSGEKLFECND
CGKPFRWNSQLILHQGIHTGEKPFDCKECGKAFRLRSQLALHQRIHSGEKPFECNKCGKA
YRLSSQLTLHQRIHTGEKPYECKVCGKAFHLSGRLTVHQRIHTGEKPFGCNECGKAFLMR
SQLIVHQRIHTGEKPYECNECGKVFRLSGQLTVHQRIHTGEKPCECKECGRAFRLQSQLT
VHQRIHTGEKPYECNICGRAFRRNLELTLHQIVHTGVKPYKCNECGKAFGHRTKLTVHQR
THTGQKPYECNECGKAFHQSGQLTLHQRIHTGEKPCECKECGKAFRLQAQLTVHQRIHTG
EKPFECNECGKTFQWRSLLIVHQRIHTGEKPFECNECGKVFRLSSQLTSHQRIHTGEKPY
ECNECGKDFQWRSLLTVHQRIHTGEKPFECNECGKTFRLSGQLTAHQKIHTGKKPYECNE
CGKTFCRRSHLTGHKRSHSGEKHYECDRWGKAF
Download sequence
Identical sequences F6QQY1
ENSMODP00000031275 ENSMODP00000031275 XP_007490137.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]