SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032707 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032707
Domain Number 1 Region: 474-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 363-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 195-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 419-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-24
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 5 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.28e-24
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 306-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.8e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 531-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 87-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 138-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.81e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 10 Region: 572-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 11 Region: 1-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032707   Gene: ENSMODG00000011021   Transcript: ENSMODT00000034287
Sequence length 631
Comment pep:novel chromosome:BROADO5:8:266714078:266756693:1 gene:ENSMODG00000011021 transcript:ENSMODT00000034287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEALTFKDVAVDFTREEWSLLSPPQKELYKEVMLENVWNLLSVGEIRPEIKVTPKESGPF
CGRTGKAKIQENLMNANNVGKHSVRAPYLAMHQRIHTGEKPYECKQCGKIFISGQSLARH
QIIHTGEKPYECKQCGKTFNQRAHLAMHQRIHTREKLHECKQCGKIFNNGYSLAQHQIIH
TGEKPYECKQCGKIFILGQSLARHQKIHTGKKPYECKQCGKTFNQSSNLATHQRIHTGEK
PYKCKQCGKAFTQSYSLAIHQRIHTGEKPYECKQCGKEFRQSSDYRKHQKIHLGEKPHKC
NQCGKTFCESSYLAIHQRTHTGEKPYECNQCGKRFITGYCLARHQRIHTGEKPYECKQCG
KRFITGYCLARHQIIHTGEKPYECNQCGKTFSQSSYLAMHQRIHTGEKPYECKQCGKRFT
SCYSIAQHQRIHTGEKPYECKQCGKTFSRSSYLAMHQRIHTGEKPYECKQCGKTFSRSSY
LAMHQRIHTGEKPYECKQCGKTFSWSSYLAMHQRIHTGETPYECNQCGKRFITGYSLARH
QRIHTGEKPYECNQCGKRFTSCYSIAQHQRIHTGEKPYECKQCGKTFNRSSNLAMHQRIH
TGEKPYKYKQCGKAFSQSSGLARHQRIHTGE
Download sequence
Identical sequences F6ZCD0
ENSMODP00000032707 ENSMODP00000032707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]