SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034153 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034153
Domain Number 1 Region: 184-458
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-85
Family Eukaryotic proteases 0.0000000331
Further Details:      
 
Domain Number 2 Region: 21-82
Classification Level Classification E-value
Superfamily GLA-domain 5.72e-20
Family GLA-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034153   Gene: ENSMODG00000019896   Transcript: ENSMODT00000035739
Sequence length 484
Comment pep:known_by_projection chromosome:BROADO5:5:283760833:283769515:1 gene:ENSMODG00000019896 transcript:ENSMODT00000035739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIVFLGQQQALSVLRRTRRANKGFLEEMRKGNLERECLEEVCSYEEAFEALESAPVTDAF
WTKYQICGSLRPSRDTFDACLQGEEGADSPVSGLLGQRADQLGEGRAAPAEEEGELVTGQ
SGWSKGSRAGPSTASGASSPLRHLPFGRLRPCCPHTPSSPPNPKSLLSAGSSSGHFHLFF
NSPPPSMDNDEKHLLNSYLGGRIVHGHNVEPGTAPWQVMLFRQRPQEMLCGASLISDRWV
LTAAHCIFYPPWDKNYTVQDLLVRIGKHQRAKYERPIEKIAKLEKVIIHPKYNWKENLDR
DIALLKLKNPITFSDYIHPICLPSKEMVQKLFLSGHKGRVTGWGNLKETWTSTKENLPEI
MQKISLPIVEQNLCRASTRIKITDNMFCAGKFGGGPRRGPRDSCEGDSGGPFVMKNPFDK
RWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKAIDKVAPLPLSTRASQSSPLCPEVN
GSAS
Download sequence
Identical sequences F7CZN2
ENSMODP00000024823 13616.ENSMODP00000034153 ENSMODP00000034153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]