SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035366 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035366
Domain Number 1 Region: 194-405
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-53
Family DBL homology domain (DH-domain) 0.0000858
Further Details:      
 
Domain Number 2 Region: 422-538
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035366   Gene: ENSMODG00000018500   Transcript: ENSMODT00000036954
Sequence length 634
Comment pep:novel chromosome:BROADO5:8:121476359:121543756:1 gene:ENSMODG00000018500 transcript:ENSMODT00000036954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSSRLQGASPPPTPLRLSPFASSPSSTAMEVEPVAATESAAQESEQPPPRRRGRRSRMSG
AAADTEAGLDVPASGPDHQRRYSLRRGSSFTFLTPGPHWDFTLKRKRREKDDDVVSLSSL
DLKEPSNKRVRSLARVSSLANLISPVRNGAVKRFECKLRSFTLRGDNRSPACAQKSFNRA
TVPTPSKRRNSVRWSEMLDINMKESLTTKEIKRQEAIYEMLRGEQDLIEDLKLARKAYHD
PMLKLSIMSEEELTHIFGDLDAYIPLHEDLLARLGEATKPDGTVEQIGHILVNWLPGLNA
YRGYCSNQLAAKALLDQKKQDARVQDFLQRCLESPFSRKLDLWSFLDIPRSRLVKYPLLL
KEILRHTPKDHTDIKPLEEALLVIQGVLSDINLKKGESECQYYIDKLEYLDDKQKDPRIE
ASKVLLCHGELKNKNGHKLYIFLFQDILVLTRPVIRNERHSYQVYRQPIPVKELVLEDLQ
DGDVRMGGSFRGAFSNSDKAKNIFRVRFRDPSPGQSHTLQANDVFHKQQWFNCIRTAIAP
FHQTTSPTEFKGLSELNKGSEKNNPLASHIKSQRKSSTLSGLIPLEVDENSPECIPSIAI
NENSTDIKAHRIQPGSPKAQEKAQLNDKRKETLV
Download sequence
Identical sequences F7DXT9
ENSMODP00000035366 ENSMODP00000035366 13616.ENSMODP00000035366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]