SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036178 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036178
Domain Number 1 Region: 10-103
Classification Level Classification E-value
Superfamily Immunoglobulin 9.51e-23
Family I set domains 0.0074
Further Details:      
 
Domain Number 2 Region: 165-263
Classification Level Classification E-value
Superfamily Immunoglobulin 6.25e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 285-376
Classification Level Classification E-value
Superfamily Immunoglobulin 5.44e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 1572-1658
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 1764-1845
Classification Level Classification E-value
Superfamily Immunoglobulin 3.4e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 6 Region: 370-464
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000034
Family I set domains 0.042
Further Details:      
 
Domain Number 7 Region: 929-1023
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000657
Family I set domains 0.022
Further Details:      
 
Domain Number 8 Region: 1662-1755
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000676
Family I set domains 0.0056
Further Details:      
 
Domain Number 9 Region: 1401-1485
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000886
Family I set domains 0.036
Further Details:      
 
Domain Number 10 Region: 1020-1116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000942
Family I set domains 0.036
Further Details:      
 
Domain Number 11 Region: 747-843
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000628
Family I set domains 0.041
Further Details:      
 
Domain Number 12 Region: 1302-1396
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000737
Family I set domains 0.026
Further Details:      
 
Domain Number 13 Region: 466-560
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000135
Family I set domains 0.02
Further Details:      
 
Domain Number 14 Region: 1111-1201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000032
Family I set domains 0.017
Further Details:      
 
Domain Number 15 Region: 848-942
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000525
Family I set domains 0.037
Further Details:      
 
Domain Number 16 Region: 1211-1299
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000389
Family I set domains 0.017
Further Details:      
 
Domain Number 17 Region: 543-644
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000337
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 18 Region: 1492-1579
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000388
Family I set domains 0.0028
Further Details:      
 
Domain Number 19 Region: 657-758
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000532
Family I set domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036178   Gene: ENSMODG00000015072   Transcript: ENSMODT00000037767
Sequence length 1847
Comment pep:known_by_projection chromosome:BROADO5:7:173073828:173097440:1 gene:ENSMODG00000015072 transcript:ENSMODT00000037767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESAVLGGAPRFLRFPRPVRAVSGADAVLRCCLTGAPAPTVLWEKDGQQLEASSRLCLQ
TEGTEHSLLVREVGAPDAGVYVCRAQNSSGEAYAAAALTVQEPSEAAPVPSEGSPDLTSL
QGPLHRARTPSPLDTDSTFLSSDPAQAPSLSQGPPGLPLEPLEGPPVFLEGPRCQWVQQG
EDVVLACQVGGQPEPAVHWEKDGRLLEDVWESSHFSLTRGPAGDGSHALRIRGIRLPDAG
VYVCHASNAHGGTVAAALLQIQPSAEAPLSAPHQGQRASAGPGQGPAAPKSFWVSEGKHA
KFRCYVTGKPEPETEWHWEGQPLSPGRRRLLYRDHDGGFVLKVLYCQPSDCGLYVCAARN
TAGHTLSAVQLHVREPRVRFAVPLEDVEGEEGGAAVLECQVPSRGITTTWYREDQRLLPG
PKYEMGEAGVMRRLIIHDLEADDDGIYLCEMRGRVRTVAAVAVKGPITRRLPRKLDVLEG
ENAVLSVEVRGAKVLGRWTRDGQELPASPRIIQTSSNHTHTLVLVGVTRQDAGVVTFSLG
SSHTSSRLRVKCMKQVPPGPPVSVELGTGCSNAALLSWKPPVPAPDTAFTYRLERQEVGT
DAWVQCLTTEAAGMVEVPGDGMPNEGDYRFRLCVVSEHGQSPYILFPGSVHLVPAVQVQR
GLQDVCVQEGDDATFSLELSTSAQGAWFLNGAELKAKGPESGSRDEVQGYLVQQHGPHHS
LLLRATRPRDSGALITFLCPGVHISATLHVQEAPVRIVLPQEKVSIEAKSLEQVVLLCEL
SRAGAPVHWYKDGLEIEESQAMVLENEGLQCRLVIPAAQPQHGGEFVCKAGEDSAFFMVT
IKEPPVKILFPQDQVCVAAESSERVVLSCELSQAGAPVHWYKDGMVAKESETLLLERKGL
HCHLILPAAQPQDGGKFVCKAGDDQAVFHVTITEPPVQIVQPQDEMFLTAVTSERVVLMC
QVSQPRALVGWYKNGMEVEESKYLVLESEGLQHRLVLPSVRLQDGGEFVCSTRDDSAFFT
LTVTDPPVRIVSPQDMVSLASLSSERVVLKCELSRAGVPVRWYKDGLEVEESRTLILENE
GPHHRLILPAAQPQDGGKFVCKAGEDSAFFNVTITEPPVKILFPRDEVSVAAVSSERVVL
TCELSRAGAPVRWYKDGLEVEENEALDGNLELRSEGTRRMLFIRAAHPSHAGNYTCQAGC
EPAAPTLTFPVQVSEPPVKVLSPEASRTGVRCAPGRDLELAVCLSGPGGAVRWYKDGERL
ASRGRVRLEEAGARRVLRVRGARSGDAGEYLCDASQDSRIFLVSVEEIPQAKLVLELTPL
TIQEGDDATFRCEVFPADAELTWLLNGTAITPCNRIETSQNGPNHTLTLRCCQISDSGTV
TAQTEGSESTARLHVREAELLFLRRLQDARTEEGQELSMEVETSRVGGQGIVTWLRGGKP
LPEDPRFSVVQDGRVHRLIIHKVMVSDQGIYCCKSHHDRTQARLLVRPEQLKVRHPLEDV
VVTEGGSATFQLELSQSGVTGEWARGGVRLEPGRNCQISAQGHNHCLVLSGLGLADTGTV
SFTTDTLRCAARLEVKEIPLAIVKGLQDLEVIEGDSATFECELSRTQADLTWDKDGQELS
PSPRLRIQALGSRRLLQLRCCGPKDAGTYSCCVGNSQASAARLTVRKKEVSVLQELKPVK
AREGDGATFKCTVSQPGIPGSWQLGGRVLRPGGRVRIRQEGNLHSLALSELQAEDSGEIQ
FQAGQAKSSTHLEVEVLPLQICRRPPREKTVLAGRRAALEVTVSRGGGHVRWLLGGVDLP
PGPKYEFRSHGVTHSLIIHNVQPTDEGTYCCQAGEDSANTNLLVESE
Download sequence
Identical sequences F6WBY2
ENSMODP00000036178 ENSMODP00000036178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]